Entry information : EsilGPx03 (Esi_0099_0085)
Entry ID 16933
Creation 2021-01-29 (Christophe Dunand)
Last sequence changes 2021-01-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilGPx03 (Esi_0099_0085)
Name (synonym) EsilGPx03 (Esi_0099_0085)
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3012]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilGPx03
start..stop
S start..stop
EsilGPx04 220 3e-74 17..185 1..166
GprGPx02 142 7e-44 22..175 1..152
VcaGPx01 139 4e-42 23..176 45..199
AeuGPx04_201684 138 7e-42 37..165 36..163
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 439040..439177 138 N° 2 443394..443483 90 N° 3 444094..444216 123 N° 4 445244..445381 138
N° 5 446038..446133 96  
join(439040..439177,443394..443483,444094..444216,445244..445381,446038..446133)


exon

Literature and cross-references EsilGPx03 (Esi_0099_0085)
Protein ref. GenBank:   CBN75459.1
DNA ref. GenBank:   FN649232.1 (439040..446133)
Protein sequence: EsilGPx03 (Esi_0099_0085)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194
PWM (Da):   %s   21204.48  
PI (pH):   %s   5.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSITVLVAFLLGLVLMYAKSLELSDFTVLDGKGNAYPLANLRHVPAVLIVNVASHCGYTDRDYRELQALRAKHDEDQLAIVAFPCNQFGAQEPGTWEEIASLADRKFGVTFPIMSKIDVNGLHSSPMFAWLKAASGNPHDIPWNFTKFLVLCDSTVKRFSHEVNPMQMDDMITNAQSFCGAGYDETGGGTGEL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGCATCACCGTCCTCGTCGCATTCCTCCTGGGACTGGTGCTGATGTACGCCAAATCTCTGGAACTCAGCGATTTCACCGTCTTGGACGGCAAGGGAAATGCGTATCCCTTGGCA
AACCTCAGACATGTTCCG
GTGAGTTGTGAACGGCACTCCTCGCTGGTGTAGACCAGAAGACGGATCATCCTACAGCAGCAGCAGGTATAGAGTAGTCTATGCATACTTCGCCTGTGTCCG
CTTGTTCAACCAAAAGCCTGATAAACTCTTTGACTTGCGTTGCGCCCATCGATGCTGCTGGACAGAATCCGACCCAACAATGTGTGTGTGACTTGAGCGCATGCATACCACGCGTGCAGC
GCGTTGGTTCGTCGGTTGCTGAGCCAAGCCGCTCGTCGAGCCACTCTGTCATCCTGCTACTCTATTTATTTCTGTGGTCTAGACCTGGATGTAATCGTGCACCGTAACAACAGAAGTAGT
TCGTAGACTGGTATGCATACAACATAAATTTACTCCAGCAGAACTTATTCCCTCGATCGCTGCTGCTGCTGCAAATGGCCGTGACTACGCGTTTAGGGTCGGCATGCAGGTACAGCCAGT
AGATGTAGTCGCTTGCTTGCTGTCGCCGTCGTTGAATGTCTCCAATGCTTCGTGTTGATCTGTTGACGTCAGCCCTCTCTGCGGCGATACATTTTGCCAAAGGCAGAAACGAACCCTTGT
GTTCGGGCACACTTGAAAAACCAGGCATGCATTTGAAATGACTTACATTTAGCAGGCATGAGGAGTAACGCGTGCTACTGCAGGGTGACATCTTCCGTATGAACTATTATTATATTTAGA
AGTACATCCTCTGCCACAGGTTGGGCCTCATCGTCGCATGTAACGGCCACCGGCGATGCTGCCAGGAGTTGAATGTTTGCGATCTATCATGTCGCTTGCGGGCCTGGCCTACGGGGTAGT
TTCTGCTCCAATGTTTTCTGTCTGTGGGTGCCTACTGCTGTTGTACACGCAACACTGCCCCCCACCCGCCCACCCGGAAATAGTGATGCCAACAGCGATGGGTTGTTCTGAAGCTAGCTA
CGCTTTGCTCCCAAACCTTCCTCGACGACACATCGGCGGGTTGCATGCCAGTTTGTTTGAGCGTACCTTTTTAGGGTAAGTTAGCCTGTGACCACGGGAGGAATCGACAGCGTCAAGTGT
TGGATCAGTACTGACATATGAAGGTACTGGGTAGAGAGAGATCAGAACGGTGAAGACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAATGGTGGTCAAACGAAT
AAATATATTTCACATGAGAAGAGGTACCATTTACTGCGTGTTTTTCATTTTCTGTCACTGTCTCGGAACAAGGCCATGGGTGGTGTTGGATTGATTGTCGTCAAGATGTCGAAGTGTGCA
TTCTTTGTAGGCAGGTTGGCTCGAGTTTCCCCGGGACCGCCGTTCGTCTGTAGTGGGCAGAAGAATATCCCTACAGTAAATAAATCACGTATAGTTCAGCAACATGCAGCATTCCATGAT
TACCAGCACTCGGTGCTCCGCGCCTCCCAAAACGGCAGCGGCAGCGTCAGAGCGAGAGCGGCGACGTGTTCGCCGGTCACCATTTTCTGGCTGCCAAGTAGGCGGACCTCTCAAATCTTC
CCGCAGTTTCGGGAATTCTGCATAGTTTGTGTAACCGCAGGGAGCATCGGACGCACACAAGACACGTAGCGTTGTAGCAAGGACATACGTCGCCATGCACATGCATGGTGGGCTGGCTCC
CAGAGCGACGACTTGGCAACTACCAGAATACTGTAACGACTCTATTTCATGTGAAGACATGAAAACAACAACACCAACAACAACAACAACTCTCCAGGTTGAACGGCAAGTTGCGAGTGT
GACGCACGGGTTTTGGATTGAGTTAAGTTCTCTCATCATCTTGACGACGGACGAACAGAAACACGGTGCCCTAATAGTCAGCGCCTCAGCACCAGCAGCAATAGCAGCAGCGGCGGCCGC
ATGGCCAAAAATATGTTGTTGCTGCCGCCCCTTGATCTGTCGGTCTCTCCCTCCTCCCTCCCCACCTGCTGGTGTTTGTTACATGGTTGATCTGGCTATAATGCTATGGTTGTCTGATGC
ACCCGCCCTTACTTCGTTCCGACTCAATTAAGAAGTATTTTCCTAGCCGCAGCGGGAAAGAAAGGGAGCGGGGCACGCTTTTCGAGAATAGCTTGCCCATGGCCAGGCACAAAATGGCAG
CTGTGTGGGCTCTTGTGCTGTGTGGCACACACACCCAATTTTTTCGGGGAATTAATTCCGCTGGGAGGGGTGTGCACGGCTTGCGGCACACAAGTTTGAGCTTCATGTTTGGTGTTGTCC
GCGAGCGAACGAGGGCGTGATGTAGGATGTAGGGTGTTTGGGCCACGCGCAAAACAATTCCGCACACTTGTCCGAATGAGAGCTGCATTTCGAAGGTGTTACAGAGGCTTCGACGACCTC
GATACTTCGAAAAGCCCGAAAAGCTGTAGTAGTAGGTGGTCCCACACATTTAAGTACGTTTTGTTTCGACAACGACCAGCAGCAGCAGCGGGGTGACATCTCCCAAGCTCAACAGCTCAC
ACAGCTGACGTGTTTTTGACTCGAACAGCCAAGCGAACCTCGACGAACCAAAAAAAAAAATTACAAATCTGGAAAAAGTGTGTCTATATAATAGGAAAAATAAAGAAAAACGGCTGTTTG
ACAACGCACATCGCACTTGCGCGCGCTAGGCCGTGTATTCGCGACGTTCCGAGTGACAAAACAAAATAATCAAGACCGAGCTCTGACTGATCGAAGACCAAAGCCTTCAAGTCGGAAGAA
AAGCCCGGACTTTTATTCCATGTAATGCCGGACTTTTATACCATGGAATGCCCGGAGTTTTATTCTAAATTTATATGCGACGGTTGTCTCCAGGTTCGCGTGTGAGCAAGTTCCCTTTGG
GATGTGTGGTGTGGATACACACCAGTTCAACCTCTGGTGGAGAGGCTGACGTGACGTACGTATTGTTGTGTTGTGAGTCAAGGGGGGGAGCAACCTTGTGTTGAAGCAAGGTTCAGCTTC
CATCCTACACTGACTCTATCTGTGGCAACACCCCGAAGGTAGATCTCCGACAGGTCATCTGACGTCACAATCTACGACAGTCTGAGGTGGCATTCACATTTATTGTATTTTCTATTTCCT
AAAAGTATGGTACTTATGTCATTGGTAGGCCGAAGATCTTTGGATATTTTTGATGTTCGAACCTCGTTACTAATATCACGGGACGTTTGTAACACGATTGTTGTAGGCCGCCGCCGAAGG
TTGATACCACAAGTAATCGACGTGGAGGGAGACGCCAAGGAGGCGTATGTAACGCCCAGAAAGGATAGATAACGCACGGCTTCCGTGTGGGCCACTTCTTCGCTGCTCGGGTGCCTTGCA
TCTCATGGACTGCTGCGCGATATCGTGAAACATTTTGTGTCGTGCTTCTAATGCATATCCCCTACAACAAATGAACGCGGAAGAAGTTTGAGCAGCCAAGTTTTACTTCTACACAACAGT
TTTTGTACTTGCACGCAACAGCAGTTCAAGCACTCCCCGAAACTGCGTCAGCTGCTTCGGAATGTTGTCCCTTCTGCCAAGGCTGTTTTTGCGCGCCACCTCTCAGCAGCAGCTGGGATG
TCTCACAGCTGATGGGTTGGAAAAATTGTCTGGTCATTTTCCGGCCAAGAGAGAGAGCGGGTTTTCCAGCGGCTTGATTCACTCCAAGAGCCTAGATACCCACGGACGCCCACTTTCTTT
TCGTTTGAAACGACCCTTACCGAACTTGACAGCAGTTTTCTTGCAGACGGCACGACTTAACGCCTACCGTATGCATATGCATACGGACAACGAAGACGTGCTCGAATAGTTTACATTTTT
TATGTATCTTGCATACGTACGGTGAGATCGAGCCCCCGGCGGCTCTCCGGGGGCCGTCTCTTCTCGCCCGCGGCGAAAATCAAGCGTGGCTGGCTGTGTATGTGTACGTGCGTAACTCTT
TCTACAGCAAAAATTGTCTTCTGTAGTAGCAGAAAATGTCTATAGAAGAAATAGGAATAGTGTCTGCCTCTAGTAACACTTCTAGTTACCGCACACGCCTGTAGTTTGTAGCTGCTACAT
ATCGGTGCTGTAGCTTCATTCTCGCCCCCTCACATCGAGAGAACGCGCAAAAAACATCTAGACGTGTCTGTCGCCTTTGCTGACTGACTCACGAGATCTCCTTCCTTTCCCTTGCACGCC
AATGAACGCACGAACGCACGCACGCACGAACCAGGCGGTGCTGATCGTGAACGTCGCTAGCCACTGCGGGTACACGGATAGAGACTACCGCGAACTGCAGGCGCTTCGGGCTAAGCACGA
CGAG
GTGATTCCGTGCTTCGGGTAGCGGGGTTCGTTTGCGGGGGGAGTTGGGGGGCTGGGATGTTATAGTCGTTTTTCGTCTGTGTAATATGTTAATCGTCGAGCTGCACGCCTTGTGCA
CTTGTCCGCCTTGTGCACCTCGGGACTCTTTGTGGCCTTCGGGGCTCATTGCAAATGGGGCAACTAGCTTGCATGGAGTAGTCGCTGTTGTCACGGTGGGAATATTTGAATATTGAATAT
TTTGTACCGTGCCGCTCTTTATGGAGGGGGCAACGGGTAGTGTGCTGCTAGACCACGGTGGGTGATGGTGCGCTGGTTGATCGCTCTCTGACTGACAGAGGCCGATTTTTGTTTTGCATT
GCTTGGAATTTTGGAGATGAAACTCTTGGTTGGTTTCTGTACGAAATGGCTACTGTCTGCACGTGTCGGACTCAAGACGGGGTGTTCATGTCACGACTCGGTTTTCAGTGGCGCGGGGGC
GAGGAATCAAACCTCTGGTTCGTCTTGCTCCTCCTCCCTCCTCTCCTCCTCCTCCTCCTCCTCCTCCTTCCCCCCCCCCCCTTGTGCATGACACCCAACGTTGTCGCTCTCTGTCCCCTT
GCCCCTTTTGCCAGGACCAACTGGCGATCGTGGCCTTCCCGTGCAACCAGTTCGGCGCGCAGGAGCCCGGCACCTGGGAGGAGATCGCCAGCCTCGCGGACCGAAAGTTCGGGGTCACGT
TCCCCATCATGAGCAAG
GTGAGCGAGATAGGCAGGAAGGTAGCAGTGGTGACGGGGAGCAGGTAACGAAAAGAGCCACCAATGGACGGGGCACACGGCAGGTGGCTGGTTGTTTCGGCGT
GAACCGGTTGTGGGCAGGGCTGGATAAGAAAAAAGTTAAACCACAGGGGACAACGGAGATGTATCGCTGGCTCAGGGAATCGTAGAAGCACAGGGTGTATCCGCCAAACGCTATGTATGA
TTTTTTTTTCCCAATCGATGCCGGGCTCTTTGCATGATTTTTTTTCCCAATCGATGCCGGGCTGTTTGTGTGATTTATCTTTCCCAATCGATGCCGGACTCTTTACCTGTGGACGTAGAG
ATGAATTCGTGGTGTTGTTTTTGTAGACGACATTTTGTAAAAGTGGGAGCTATGTAGCGTGCGTGCCGCGGGGGGTGCTAGGCGATGGGACAGGGTACACACCGCGGTGCGTGAGGTGTG
TTGGTTTGGCGTGGCGTGCGGTGGGGCTGGATGCAGAGAGAGCGTCTGGCGTGGCCTGGCCTTGTGTTGTTTGTTCTGCCCACCACACGACGACATGGTCGGGTGGGTTGCATCGGGGGT
AAGGTGGCGTATATCATGTCGTCATGGAAAGAGGTGTGGTGAGAGCGTGGCAGCGGAAGGTGTTGGTGAGGTTGCAGGCGCACATGGCAAGTTGTTTTGGAAAGATGGTGAGCTCGGCAC
TGCTAAAGGGCAACGTTGCGTTTCACCACACCGGACGGAACACGGAAGCTAGCGGTTCAGTGTACGTTGTAGCCGTGGCGGCCCTTTCAACAAGCGCCAGCCCCACTCGCGACTGCTTGC
CCGTGATGGATGCCATGCCCCCTGCGTTCTCTCAAGCAGGGGCCATGTTTATGCCAGTGTGTTGTCAATCCTTACGCTTGTGCTTTGTGGACGTTTCTTCTCCAAGGACTGACCCCCCCC
CCCCTTCCCTCTCCCTTGTTGTTTCTCTGGTGACGACGTTCTCCGCTTTTTACTGGAATATCGACGACGTCTACGGCCGACTAGATCGACGTGAACGGGCTTCACTCCTCCCCGATGTTC
GCGTGGCTCAAGGCCGCCTCGGGCAACCCCCACGACATCCCATGGAACTTCACCAAGTTCCTCGTCCTGTGCGACTCGACCGTCAAGCGATTCTCGCACGAG
GTGGGTGGATGACTTGCT
TTTGCCGTAAATATACTCCTTGTTCGATCGTTTGTTGTAGCTGCTAGCTGCGGCTGTACACCGCCATCCCGCCCGCCTCGCTCCTCCCCACCACGCTTGGAACCAACAAGTGTGGTTCGA
ACCAACAAGTGTGGTTCGAACCAACAAGTGTGGTTCGGAAGCCGTAGTCTCCCGTCAATTGGGCTGTGTTCTGACCTCAAGGGAGTGACTGAGTGACTACTTTCGTAGATTTCGTGTTGC
CACCGATGGGGTCTGTCAGGGGGCATGGAACAGGCGATCCGATGCGATCGATCGCGAGCGTGCTTTGTCCTCTCTCACTGCCGCTGCATCCGTTAGCTTACCGTGCCGTAAACGCGCATC
ACATAAGTGGTGATATGTGTACCCGCGGTGCAGTGAGTAGGGTACGCAAGCCTCCCCGGCGGGGATTGGTCGTGATGAACGTGTTCGCGTGCGGGCACTACGGTATGGTACAGAATGACC
CCGATATCATGGCGCTTCACCCCCTCCAACCCCATTTCCCGCCCCACGCAAGGATGAGCCTATCCTCACCCTCCCTCCTTCGCAGGGTTTTCGGCAGCATGCATGCGTGTTTTGACGTGG
TGTTGCAATTTCACGATTTTTCCCTCTTGTGCCGTCAGGTCAACCCGATGCAAATGGACGACATGATCACCAACGCTCAGAGCTTCTGCGGCGCTGGTTACGACGAGACGGGCGGCGGCA
CCGGGGAACTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGCATCACCGTCCTCGTCGCATTCCTCCTGGGACTGGTGCTGATGTACGCCAAATCTCTGGAACTCAGCGATTTCACCGTCTTGGACGGCAAGGGAAATGCGTATCCCTTGGCA
AACCTCAGACATGTTCCG
GCGGTGCTGATCGTGAACGTCGCTAGCCACTGCGGGTACACGGATAGAGACTACCGCGAACTGCAGGCGCTTCGGGCTAAGCACGACGAGGACCAACTGGCG
ATCGTGGCCTTCCCGTGCAACCAGTTCGGCGCGCAGGAGCCCGGCACCTGGGAGGAGATCGCCAGCCTCGCGGACCGAAAGTTCGGGGTCACGTTCCCCATCATGAGCAAG
ATCGACGTG
AACGGGCTTCACTCCTCCCCGATGTTCGCGTGGCTCAAGGCCGCCTCGGGCAACCCCCACGACATCCCATGGAACTTCACCAAGTTCCTCGTCCTGTGCGACTCGACCGTCAAGCGATTC
TCGCACGAG
GTCAACCCGATGCAAATGGACGACATGATCACCAACGCTCAGAGCTTCTGCGGCGCTGGTTACGACGAGACGGGCGGCGGCACCGGGGAACTGTAA

Retrieve as FASTA