Entry information : EsilVBPo01 (Esi_0009_0080)
Entry ID 16936
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilVBPo01 (Esi_0009_0080)
Name (synonym) EsilVBPo01 (Esi_0009_0080)
Class No haem, Vanadium bromoperoxidase    [Orthogroup: VBPo001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilVBPo01
start..stop
S start..stop
LdVBPo02 881 0 5..639 42..677
LdVBPo01 880 0 5..639 6..641
LdVIPo01 441 9.15e-148 14..616 33..624
AnoVBPo 431 5.82e-145 42..616 8..555
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16936' 'join(1..6,704..841,7876..8189,8545..8593,8949..9042,9420..9661,10238..10516,10785..10892,11039..11212,11619..11786,12232..12342,12582..12749,12925..13002)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..6 4 N° 2 704..841 136 N° 3 7876..8189 312 N° 4 8545..8593 47
N° 5 8949..9042 92 N° 6 9420..9661 240 N° 7 10238..10516 277 N° 8 10785..10892 106
N° 9 11039..11212 172 N° 10 11619..11786 166 N° 11 12232..12342 109 N° 12 12582..12749 166
N° 13 12925..13002 76  
join(1..6,704..841,7876..8189,8545..8593,8949..9042,9420..9661,10238..10516,1078 5..10892,11039..11212,11619..11786,12232..12342,12582..12749,12925..13002)


exon

Literature and cross-references EsilVBPo01 (Esi_0009_0080)
Protein ref. GenBank:   CBN73942.1
DNA ref. GenBank:   FN649137.1 (505876..518877)
Protein sequence: EsilVBPo01 (Esi_0009_0080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   642 (623)
PWM (Da):   %s   69899.31 (68088.3)  
PI (pH):   %s   6.39 (6.32) Peptide Signal:   %s   cut: 20 range:20-642
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAFVGIAALLAASPPCLGATSNEEHQPTHPLLSGSVCRVRDSLD
FLS
PTERAKVTLQKRVDTAKEEFQVGPTCHITNGDETNVPDFIGQFHKSLPHDKFGTVSKTSYQKLLDCVFSADVNVCDQVPSGASARGAKMINPLGGTAHQVDGADSDNVFITTPDGVLS
EE
AAQMAEVYWMALTRDIPFSEFATNSLVRAAAENLERLPAFKGLNIPKSAGGKIDPVQDLFRTDWPGVTAGPVVSQLLLSDFAIDNIVVPPKQVTLVKEMDYMTTFQDWLDVNGASKVK
TEFVDEDKPLFIRNGRDLAALAFTDLLYTEAFRAALVMFRQGILSSAEGPYSTSERQVGFATFGEPHILTSLAASSSSTRHAWYAK
WQVHRVLRPEAYGGLVHNTLTGRLHTPLPKAILQ
NT
ELLNRVRTHNAKCNGDGKGGHGDGTYLLPMAVAEGSPVHPAYPSGHAINLGAYITTLKAFLGFELGQRCYLGDLVVSNDEGTKRIEYVPRKGETCIDQNGREVQGLTYEGELNKVASN
VIIGRSHIGVHYRMDGVYGALMGETSAVRRLQQ
ELPNLSEARDTKGSIPPASYKFRLYSGKVLELLAKDIFKLDGRTCKGLYTGDDFCDEHQDGGHYLEHLVNKGGDFAFHVEL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGGTCGGTTGAATGTTTCTGTTCTGTTCCGTCATATCCGAGAATCAGCAATCATCTTATCGTTTCAAATAGCTTTTTCCTGAGACCGACACAGTAGAGTGGGGGTTCTAGTGGT
GGCTGCACGTAGTAACAGACTGTAGCTGCGGTTGAGCCCGTGATATACGTCTGTCCCCCGTAGCGCGCCCCCACCGTATGACTGATATGCATTTGACAGACCTGTTCAGTATTGTCGCAA
AAATAAGCGGAAATCAAGATACTTCAAGCTACTGCTGTAGCCAATGCCACACTAAATTACTGGTCAACAACCAGCGCGCTACAGTCCCAATGACGAAGAGCACCCATGGGAGAGCGCATC
GGTCTAACGCCGATGCGAACAAGTACTGCATCCGTTCATTTGCCGAATCAGAGTAAGTGCCCGTTTTTGGCTGTATGAAATGTCTGCGCTGCTTTCTTTCGTGGCGGAGCACCGGAGCAC
AGACCACATCGAATACTGAAGATATGACACCCTTCAGCGTTCACACGATTTTCGGGCATTCACCTACTCCGTAAGTACCACATGTTGTGCCTTGCCACACCAGCTACCGGTTGGAGCGTA
TTTTCCCCGTCGTCAACGGCCTCTGGCACAACATGTGGCGAACTGGTCGCCTGAGATCCAACCGCTTTCCCAATGGAAAAATTGATTCCATGACCTACCATGCAGGCGTTCGTCGGCATT
GCAGCCCTACTCGCGGCCTCCCCTCCCTGTCTGGGCGCCACCAGCAACGAGGAACACCAACCTACTCATCCTCTCCTGAGCGGGAGCGTGTGCAGGGTCAGAGACTCTCTGGACTTTCTA
AGC
GCGTAAGTTTGCGTTTGGTGTTCCAACTGTTGATTCGATATCGTAGGCGTGGTGCATGGAAGCAGGAGCGCTACGGGTTGCGAGATGTCCTCATGGCTTCCTGCTCGTCTTCCGGTA
GATCGGAAAACGCGACACGTGCAACAACGACGGCATGTTCGCTCCGTTTGGTGTGCGCTCTCCGTTCGGGTTGTTGGCCCCCACTCCGTATTCAAGAATACCGATTCATTTCATTAACCA
CGTCTTTCACGACAGAGTGTGTTGTATTGTTGCGGACGAAAAAAATAGGAAGGTTTGTTCGTCGAAGCAGATAGAATAAACTGGTGTTTATTTTGTAACAGTCGAATTAGAATTTGGTTT
CATTTTCTACCGGAAACCCAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTGGAAGCACCCGTGCTGCATAT
GTGATGTCAGCCTCAGCACGGGACGCGCCAATGAGTGGAAGCACTCGTGCTGTTGGCGAGTAGAGTTAACCGATCTCAAAAAGAAAGAACAAAACGCCGTACACGTATCAGCACGGGACG
CGCCAATGAGTGGAAGCACCCGTGCTGTTGGCGAGTAGAGTTAACCGAATTCAACGCAGCGGTACAAAAATACCACAAATCACGCATCAGTACGGGACGCGCCAATGAGTGGAAGCACCC
GTGCTGCATATGTGTTGTCAGCCTCAGCAAGGGACGCGCCAACGAGTGGAAGCACTCGTGCTGTTGGCGAGTAGAGTTAACCGATCTCAAAAAGAAAGAACAAAACGCCGTACACGTATC
AGCACGGGACGCGCCAATGAGTGGACGCACCCGTGCTGTCGGCGAGTAGAGTTAACCGAATTCAACGCATCGAAAACGAAGTCGTACACGTATCAGTACGGGACGCGCCAATGAGTGGAA
GCACCCGTGCTGCATATGTGTTGTCAGTTTCAGCAAGGGACGCGCCAATGAGTGCTGTTGGCGAGTAGAGTTAACCGATCTCAAAAAGAAAGAACGAAACGCCGTACACGTATCAGCACG
GGACGCGCCAATGAGTGGACGCACCCGTGCTGTTGGCGACTATAATTAACCGATCTCCACGCATCGAAACACAAAGTCATACACGTATCAGTACGGGACGCGCCAATGAGTGGAAGCACC
CGTGCTCATATGTGTTGTCAGTTTCAGCAAGGGGCGCGCCAATGAGTGGAAGCACCCGCGGTGTGTACATGTATCAGTACAGTCGCGCCAATGAGTGGAAGCACCCGTGCTGCATATGTG
TTGTTAGTTTCAGCGAGGGACGCACCAATGAGTGGAAGCACCCGCGCTGTTGGCAAGTAGAGTTCACCGTATCCAACGCATCGATGAAAAAAAAACACGTATCATCACGGGACGCGCCAA
TGAGTGGAAGCACCCGTGCCGATGGCGAACCGGGGTTCACCGAATCCAAGAAAATATATATATATATAAAAAAAAAAGAGAGAAACCATCGCTAGTGTTCCAAAGAGAGAAAAATATTCG
GGATTGGTCGACGTCCGGTGACCGTAGCGTCAGCAGCAAAAAATCACTCCATTCAATCCACAGGCGTCGAGAACGAACTAACGCGAGCTCGCGATATAACAACGCGTCGTTCTGGGCCCG
ACGAAAACCCACGTCAGATAGTTTCGCCCGAAGATAGGATTTGTAGACCATTCTAACTGCAGATCCAGGCGCGCGATCGACTACGCCCACGATGAAGAGGAAAAGAAGTGTTCCCGCAAC
GCCGCCCTGACGCTCGCCCGCCGCCTGCCGCCGGTCCGCTGCTTATACGACTCCAACCGCGACCAGATGCCGACACGGGCCTCCACGCGGAGCGGCAGGGCAGCGGCTGGGCAAGCAGGG
CGAGGTCGGGCGCCGACACCTTCGACACCACGCACGAGGAGGTCTACCGCGCGATCGGTGGCGAGCTCGACGGCTCGCCCCTCGACGCGCAGCGGATCACGTACTCCCGCGAGGCGTCGA
GCGGTATCCTCCTCGCGAGCGCCAGGGACAGGCACCCGCGGCGACCCCCCCGCTGATGAGACTGAGCTCGCTTCTCTCCGCGGGCTGGTGGACGGCCTGAGGGAGGAGCTGCAGCGGAAG
CGCGATGAGGCTGCCGGCGATCGCCAGCAGCTTCAAGCAACGATCGACGACCTGATCGCCACCCAAGCAGCAGGACCTGGCCTTCCGGGGGGGGGTGCAACTGGTGGGCACAACCGCCCC
ACCATCGGCCTCTCGGGCCCCCGCTACACCCAGCGCCGAGGCGGCTAAGGCTACGGCAAAGGATAGAGCGCGGATGCGGGGGGACCTCCGCCGGGTAAAAGCGTGGCTCATCCTGGGGCG
GCCTCCGGCAGTTTCAAAACTGTCTCAGATGGAGTGGCAATCCTTGCTTCGCAAAGGCGTTCTGGTGACAGAGAAAGTGGCGGCATCGCTCGACACGCTCGTGGTTACTGCCTCGCCTTC
AACTCGTCGTCCGGTTGCCATGATCGTAACTGCCCACACATCCACGCCCAGAACCCTTCCCACGCTAGGCGCGGAGCGTCCGAAACTCCGGCAACCGGCGCGCGCGGCGTTGGCCACGGC
AACGGGGGAGGGCGCGGAGGAGAGGCGCGCGCCGCTGGCGAGGGCGGCGCGAGACCCAAGGCCGCTGACTTCTTCACCCACGGGAAAGACAAATAGGGGTGCGGGCTCTCCCGCGTAGCG
GGGGGGCCTACCTCGGATGGCAGCGCACCTGCGGCTAAATCGAACGGCAGCACGCCGGTCTACACGAGGTTGGCTCCAGGGCTATCAGCAGGTTCAGGACCTGGGACAGGCAGGACGGGA
CTTTGTTACCGACGTCTTGGCATGCAGCTCGTCGAGCACTCAGTTGCGTCTTCGTCTAGAAGGACTTACACGTCAGGCTTCAACTCTTGGGGCACGTTTCGCAGGCTGACGGAGAAGCCA
AAGTTCCTAGGGCAACGTGCCGGGGACCTTCATGTGTGGGAGTTGATAGACTTCGTAGCCTGGTGTTTCGAGTCTGAGGGTAATCTAGCGAGTACAATATCCGGAAAACTCACGGCTGTA
CAACATCTTCATAGGCTGGAAGCTTCTGTCGAGCTAGATTTGTCGTCTCCGATGTTGAAATGTGCGCTAAGGGGGATTGCGAGAAACCACGTGGCTGTGGGGACGGTACGCCGTGTGCGC
CTGCCTGTGTCTTGGCGTATGCTGCTGGACGGGGAAAGCGCAAACCAGAACTGGGGGGGAAGGGGGCAGAGTGATGTGGCTGTGTCTGTGCTTGTCCTATCTCTTTATCACACGGTCTGA
TGAGGTGTTCGCGAATGATGCGGGCAGGGTGCATGAGGCACACTGTCTTACGAGGGCGGACGTAGCATTGTTTGCTGGCGAGACGCAATTAGTCTTTAGTCACTATCGTAGAGCAGACCG
TGTCGAAATGCGGTTTAGAGGGCACAAGGCCGATCAAGAGCAGAAAGGAAACATACGGGTTCGTACGCGAGACGAAGTCGCCGGACCGCAGTCAGGTGTGAGAGCACGCGGCGGCGCGGT
GGCTCTTGTGGTGGAGCTGTTATCGTGTCATGCGACGTTGCCTGACTCCGCACCGTTGGCTTCGTACCGTAGTGGAAGAGCAGTGAGAGTAGTGAGGTATACTGCTGCCCTCCGTGTAGT
CAGAGAAGTGGTAGCGAAGTCGGGGCGTAACCCCCAGGAGTACGCGTTGCACTCGTTGCGAATTGGAGGCGCGACGGCTCTTGCATCGGGCGGAGACATCGCAGAACGAGTGATTCAGAG
AGAAGGGAAGTGGAGGTCGGATGCATACAAGCCGTACGCGCGAAACAATGTAGAGGATTCGCGGCGAGTGTCACGGAAACTTACAGACGGCAGTAGGATCGTATCGAGACAGCCGGGGGA
GGGGACCGTCTGGGGGAACGGATAGTTGACTTATTCGGTAGTCGTCCAGAAACTGACCTCGATGTGGGTGTTGTAGAATGGTGTGTACCATTTGAGGACTTAGTCAGTTTTGGGACTCCT
GCGTTTGCAGTCGTAGTCCCTCGGCTAGTATTTGTGGGGAGAGAGATGGATTTGTAAGAGTTGACGCCGGCCTTTGCAGCTAACGCGGCCGGAGAGACGATGAGCGTTTCGTGCGTCTCT
CTCCCCAACACGTAGCCTAGAAACCGAAGAAATAATGAAGCAATTCGAAAGAAAACAAAATAAAAGGAAGGTTTGTTCGTCGAAGCAGATAGAATAAACTGGTGTTTATTTTGTAACAGT
CGAATTAGAATTTGGCTTCATTTTCTACCGGAAACCCAGGGTCACGGTGTTTGGAATTATTAGTCTATAGTTGGGGGTGTCATTCCGTGATCGAGTCCATGCAGGGGCTGTAGCAAAGTC
GGGTAACGTGTGACAGCTACAGAGCGCGTGAAGCAACGGAAGGACAGCAGCAGCCGCCTAACGCAGTAGCGGCGGCAGTTTAGAAAATCCCGCCCTCCCATGTACAGTACATCCATAGCA
TTACTTGATTCCGACACACTTTGACGTCATCACCGCGGAATAACCTGCAACCTAGAAGCATCCTCCGCTGTCCCACATAGTCAGGACTATGTACAGCAGTGGCCTACATATAGACCGATC
GACATGGAAATCTAGAAAAGGCAACGGCGTCATACGGTGCTGTAGTCCTCCTCTTTGTTTATCGTTCCTCGTTCTGCAGCCGACCGAACGTGCCAAGGTCACCCTCCAGAAGCGGGTTGA
CACGGCGAAGGAAGAGTTCCAGGTCGGACCCACCTGCCACATCACCAACGGAGACGAGACCAATGTTCCGGACTTCATCGGGCAGTTCCACAAGTCGCTCCCTCATGACAAGTTCGGGAC
GGTGAGCAAGACGTCCTACCAGAAGCTCCTCGACTGCGTCTTCTCGGCAGATGTGAACGTTTGCGACCAGGTGCCCTCGGGGGCCAGCGCCAGGGGGGCCAAGATGATAAACCCGCTCGG
TGGCACCGCACACCAGGTCGACGGCGCTGACAG
AGGTATGGATGGGATGCGAGCGTGTTCCGCCCGGTGCCTTCGTGCGGCAAACGTGTTGTTCTTGGCGTTTATTTGTGGTGGTGATGG
CGATGACGTTGTTGTTGTTGTTGTTGTTGTTGGTTTTGTTGTAGTTGTGCTGTCTTCTTTTTCTTGTCGTTGTTCATGCCGTTATTACCATGGGAGCTGTGGTACTCATGCGGGGTCATG
TTGTTCGAGATGCCCATATTTCCCCCGATCACCCTCAGAAGTATGTACGTCAAGTGTAGTACCCTGATTTCCCATATTGATCTCGACTCAACACTTGACGAAATCACCCGTGAACCTCGC
CTGCCGCTCCGTTCGACGACGAATTTGCAGCGACAACGTCTTCATCACCACGCCCGACGGCGTGTTGTCCGAAGAACTGTGGTGAGTTCCCCTCGAGGTATATTTTATTGTCGAGGCCCT
CGTCAGAGTGTCGAACACGTGTCGTCCATCTGGTAATGTTTGCCCACGTGTTTGTGATTCGTTCAAGTCTATTTGGGCTACCGTAGTTATCAGGTTGGCAAGCACAAAGGTGTTGCCCAA
TAGTAGTCGATCGTTTTCGCCTGTTTTCCGTAAAACTCCCACATTCGCTTGGTTCCTTCCTTTCCGCAATAGTTCCTTGTTGATCATCTGTTGACGGGACACGATGATGACGAAACTAGC
CCCCCAAGCACTGCTGTCAATGAGTTCTCATCCTTCGCGACACATGTACGCAACCCCAACGACCTCGGTGATCCAGGCCGCGCAAATGGCCGAGGTGTACTGGATGGCCCTCACTCGAGA
CATCCCTTTCAGCGAATTCGCGACGAACTCCCTCGTCCGCGCCGCCGCAG
AGGTGAACTGCATTGCAACTTGAGGAAGTAGACTCACGTAGAACGTATTTATTTCGACACCTCTGTCGAT
GTTCATGCCTCACACGGCTGCTGCAAATGACTACTTTTACAGTTGGTTGCGGCAGCGGTGGTTTCTCCAAAGCCAGCACTTCCCCTCGCTGGTAAATGTGACGTGTCTCGTGGCTGTTGC
GGGAGTGACTTTCGTGCCCAAAAGCGAAACCTCAGTTGAACGTTTCGACGAAGCACGCCTGTCTGCTTCCGTCAGCCCACCAATGATCACCCCCATCGGGCGAAAGCGTCCACGACTAGC
AGCCTGACAAGCCCTCTCTCAATGTATTTTCCACGCCTCCACACACCGAACACGCCTTTTTCACGACAGAAAATCTCGAGAGGCTCCCGGCGTTCAAAGGCCTCAACATCCCCAAGAGCG
CGGGTGGAAAGATCGATCCGGTGCAGGACCTGTTCCGAACGGACTGGCCTGGCGTGACGGCCGGCCCCGTGGTCTCGCAACTCCTTCTCTCGGACTTCGCGATCGACAACATTGTCGTAC
CGCCGAAGCAGGTCACCCTGGTCAAGGAGATGGACTATATGACTACCTTCCAGGACTGGCTTGATGTTCAG
AGGTGTGGGAAATTGTTATTGTTGTTGTTGTTGTTGCTGTTGAGGATGA
TGTTGTTTTGGTCGTGGTCGTCGTCGCCAATGTTCGGTCTGGCGTTGTTGCGATTGTGGCGGCTGTCCTCGCGTTCGGCTTCAATTCGCCGCCGTTGTCGGTACAAGTTAAGTTTCGTTA
CCGTTGTAGTTGGGGCTGCTGAGTGTGGCTATGGTATTGTTGATGTCGTCTTGATCCAGGGGTCGGGGTTTACTGTGCCACACGATTAACAACGAATAGCCACGAAATACACTCTCATTA
GAGCGCCAACTGCGTGTTCAGATCCCCGAACCGGCCTGGTTTGTTTCGTTCGGAACGCCATACTTGTCTTATCGCTGGCTAAACGTGTAAGGCGCATATCGTTGGTGTGCGTGATTTTTT
AGTCGTTGTTTCCAAACCCAGCTAAATCCGCGGTTCTGAAAACCATGAATATCTGCGACATTAATTCTACGTCCCTGGGAGCAAGACAACATGTTTGTTCCCTCCACCACCCACATATCC
CCCGCCGGGCCCATGTCCTCCTTCATGCTTACCCGGACTGCGCGCGCAGAACGGCGCCTCCAAGGTCAAGACCGAGTTCGTCGACGAGGACAAGCCGCTCTTCATCCGGAACGGCCGCGA
CCTGGCCGCGCTCGCCTTCACCGACCTCCTCTACACCGAGGCGTTCCGCGCCGCCTTGGTCATGTTCCGCCAGGGCATCCTCTCCAGCGCCGAGGGCCCGTACTCCACCTCCGAGCGGCA
GGTCGGCTTCGCCACCTTCGGGGAGCCGCACATCCTCACCTCCCTCGCGGCCTCCAGCTCCTCCACTCGGCACGCGTGGTACGCCAAG
AGGTGCGGAGAACCTTTTGGCCTTCCTCGCAG
AGAGGCGAAAAGCCCTCAGTGGTTGGTCTCCTCCTGGAAATTTTCAAAGGTTTTGTACCCGACTTGTTTCGCACAAGTGATCTGTGTTTCTGAAAGGAAGGCTGTTTCCATGGTCTATTT
CCCCACCAAGGGACCGATGTCCCTTCCCGTGCCTGTGTCGGCGTGCCTAACGCCCTTCCCATCTCTGCTCCCGACCCTTCGTTCTCTCAACCTCGTTGGTGTGGCAACGCAACAACAGTG
GCAAGTGCACCGCGTGCTAAGGCCCGAGGCGTACGGGGGCCTGGTACACAACACGCTCACCGGTCGACTGCACACACCCCTGCCCAAGGCTATCCTCCAGAACACG
CGGTCAGTTCATCC
CGCACGCATAGTCTTGGTTGCTCAGAGTAGAGGGGCCTGAAATTCCATCTCATCAGTTTCGACTTTCCCCCAAAACACATACACGAGTATGTTGTAAGGCACTCATGCTGTCACTCTTTG
GTCTTCCATTGCAGGAGCTGCTGAACCGAGTCAGGACGCATAACGCCAAATGCAACGGCGACGGCAAGGGGGGGCACGGAGACGGGACCTACCTGCTCCCCATGGCCGTCGCCGAGGGGT
CACCCGTTCACCCGGCCTACCCAAGCGGACACGCGATCAACCTTGGTGCCTACATCACCACGCTCAAG
AGGTGAGGTGACAAATTTCAATGTGTAGGTAGACGGAGATGGAGAGGGAACA
ACTATGTCGCTGCATCCTAAGGCAAGGCAAGATATCATGCAGTAGATCTAAAGGCTCCTTGAGCGCACGTCCAGCTACGCCCTCAGCGGCAGCTGGATCGGGGCCTGCGGTGTCGACAAT
ATCTCGTTCCGGCTACCACCTTCCATGCAACACCCCATGTCAAACACAACCTTGTGCACATTGCCCATGAAGCCGGTTAACAGACACGCACATCAGAAGCTTGAGATGATAAAACGATAG
GTGCTTCAGCCGTTTCGAGCGATTCTGCCCGATTCGCCTTGCCAAGTTGATTTCCTCCTACCCGTGCCTCCTCCCTCCCCCACCCTCCTCCCATTAATACGAAAACCCTCTCTTAGGCGT
TCCTCGGCTTCGAGCTCGGACAGAGGTGCTACCTTGGGGACTTGGTGGTCTCCAACGACGAAGGCACCAAGCGGATCGAATACGTCCCGCGCAAGGGAGAAACGTGCATCGATCAGAACG
GGAGGGAGGTCCAGGGACTCACGTACGAAGGCGAGCTAAACAAG
AGGTGAGAGGTCGATGCGGTGGGCGTACAGTTGCTTCTACGAGGTGTACTGGGCTGGTATGCCAATGTGGAATCGT
GGTTTCCGCCAAGATGTGACGCATGTCGTTCGGTCTGTGTGGCAGGTATGACTTCAGACTCAGACACATTGGAGGTTCTGTTTCCGTGTGACATCAAGCGCTTCCCAATTCACAACTACT
TGCCGTTCGATATGTCGCACTTTCCTTTTCTTCCTCTCGGTGAACGTTTGCCTATGTCAACAGCTGCGGCATGCTATCACGATCCATCCGTCGATGGGCCGCTAGTGTTCCGTTTACTTC
AACGTCGCCTTGCACGGTGCTCTAAATCCGGAGCACGATTTGTCTGACATATGTGTGTGTTGAGCTCAACCCTCTCTCGTGCGAACGTTTGCATCTATTGTACATCACCGCCGACGGGGT
GGCCGTTTCAGGTGGCGTCCAACGTCATCATCGGCAGGTCTCACATCGGCGTACACTACCGGATGGACGGCGTGTACGGCGCCCTGATGGGCGAGACTAGTGCTGTCCGCCGGCTGCAGC
AG
AGGTAGGAAGTCTTACGTTGAAATGAAACGCTGTGAATGTGTTCCATCGCGCTGACCAGGTCCAAGTGCACGAGCAAGTCAAAACAGTGTGTGACACCGGGTACATAAAAAAATCCTC
TTCGACTACGAATGTCTGTCTCCTCAATTTTCTCCAATGAAACTTTTGTGTGCGTATTGTCGATTTAAGCTTCTCCCGAGCACGCTCACCTCCCGTCTTTCTGCTACGCACATTTTGTTC
TAGGAACTGCCCAACCTTTCGGAGGCCCGCGACACCAAGGGCAGCATCCCGCCGGCCTCGTACAAGTTCCGCCTGTACAGCGGGAAGGTTCTGGAGCTGCTCGCGAAGGACATCTTCAAG
CTAGACGGACGGACGTGCAAGGGTCTCTACACAGGAGACGACTTCTGTGAC
ACGTAAGTGGATATGAGTTACACAGCCAGCCCTGGTCGTTGATCGATGCCATCGACGTGAATGACCCTC
GACACCACCTTACTACCAGATATTTCGACGACTCAGTAGACTTGATCATTTTCTCGCTCTGAGAGCCTCCCCGCTACTCCATCACTGGCATGCTTCGTATTTCCCCAGGAGCACCAGGAC
GGCGGCCATTATCTGGAACACCTCGTGAACAAGGGTGGTGACTTCGCTTTCCACGTCGAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCGTTCGTCGGCATTGCAGCCCTACTCGCGGCCTCCCCTCCCTGTCTGGGCGCCACCAGCAACGAGGAACACCAACCTACTCATCCTCTCCTGAGCGGGAGCGTGTGCAGGGTC
AGAGACTCTCTGGACTTTCTAAGC
CCGACCGAACGTGCCAAGGTCACCCTCCAGAAGCGGGTTGACACGGCGAAGGAAGAGTTCCAGGTCGGACCCACCTGCCACATCACCAACGGAGAC
GAGACCAATGTTCCGGACTTCATCGGGCAGTTCCACAAGTCGCTCCCTCATGACAAGTTCGGGACGGTGAGCAAGACGTCCTACCAGAAGCTCCTCGACTGCGTCTTCTCGGCAGATGTG
AACGTTTGCGACCAGGTGCCCTCGGGGGCCAGCGCCAGGGGGGCCAAGATGATAAACCCGCTCGGTGGCACCGCACACCAGGTCGACGGCGCTGACAG
CGACAACGTCTTCATCACCACG
CCCGACGGCGTGTTGTCCGAAGAACTG
GCCGCGCAAATGGCCGAGGTGTACTGGATGGCCCTCACTCGAGACATCCCTTTCAGCGAATTCGCGACGAACTCCCTCGTCCGCGCCGCCGCA
G
AAAATCTCGAGAGGCTCCCGGCGTTCAAAGGCCTCAACATCCCCAAGAGCGCGGGTGGAAAGATCGATCCGGTGCAGGACCTGTTCCGAACGGACTGGCCTGGCGTGACGGCCGGCCCC
GTGGTCTCGCAACTCCTTCTCTCGGACTTCGCGATCGACAACATTGTCGTACCGCCGAAGCAGGTCACCCTGGTCAAGGAGATGGACTATATGACTACCTTCCAGGACTGGCTTGATGTT
CAG
AACGGCGCCTCCAAGGTCAAGACCGAGTTCGTCGACGAGGACAAGCCGCTCTTCATCCGGAACGGCCGCGACCTGGCCGCGCTCGCCTTCACCGACCTCCTCTACACCGAGGCGTTC
CGCGCCGCCTTGGTCATGTTCCGCCAGGGCATCCTCTCCAGCGCCGAGGGCCCGTACTCCACCTCCGAGCGGCAGGTCGGCTTCGCCACCTTCGGGGAGCCGCACATCCTCACCTCCCTC
GCGGCCTCCAGCTCCTCCACTCGGCACGCGTGGTACGCCAAG
TGGCAAGTGCACCGCGTGCTAAGGCCCGAGGCGTACGGGGGCCTGGTACACAACACGCTCACCGGTCGACTGCACACA
CCCCTGCCCAAGGCTATCCTCCAGAACACG
GAGCTGCTGAACCGAGTCAGGACGCATAACGCCAAATGCAACGGCGACGGCAAGGGGGGGCACGGAGACGGGACCTACCTGCTCCCCATG
GCCGTCGCCGAGGGGTCACCCGTTCACCCGGCCTACCCAAGCGGACACGCGATCAACCTTGGTGCCTACATCACCACGCTCAAG
GCGTTCCTCGGCTTCGAGCTCGGACAGAGGTGCTAC
CTTGGGGACTTGGTGGTCTCCAACGACGAAGGCACCAAGCGGATCGAATACGTCCCGCGCAAGGGAGAAACGTGCATCGATCAGAACGGGAGGGAGGTCCAGGGACTCACGTACGAAGGC
GAGCTAAACAAG
GTGGCGTCCAACGTCATCATCGGCAGGTCTCACATCGGCGTACACTACCGGATGGACGGCGTGTACGGCGCCCTGATGGGCGAGACTAGTGCTGTCCGCCGGCTGCAG
CAG
GAACTGCCCAACCTTTCGGAGGCCCGCGACACCAAGGGCAGCATCCCGCCGGCCTCGTACAAGTTCCGCCTGTACAGCGGGAAGGTTCTGGAGCTGCTCGCGAAGGACATCTTCAAG
CTAGACGGACGGACGTGCAAGGGTCTCTACACAGGAGACGACTTCTGTGAC
GAGCACCAGGACGGCGGCCATTATCTGGAACACCTCGTGAACAAGGGTGGTGACTTCGCTTTCCACGTC
GAGCTCTGA

Retrieve as FASTA