Entry information : EsilAOX01 (Esi_0071_0022)
Entry ID 16937
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilAOX01 (Esi_0071_0022)
Name (synonym) EsilAOX01 (Esi_0071_0022)
Class Alternative Oxidase    [Orthogroup: AOX002]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilAOX01
start..stop
S start..stop
CreAOX01 271 4.23e-88 124..364 121..357
CreAOX02 253 1.23e-81 131..364 87..313
ThasAOX05 211 3.84e-65 120..353 104..329
AtAOX03 206 3.25e-63 104..362 88..354
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16937' 'join(104163..104414,105015..105185,105538..105658,107127..107223,107802..108027,108314..108438,108767..108839,109248..109451)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 104163..104414 250 N° 2 105015..105185 169 N° 3 105538..105658 119 N° 4 107127..107223 95
N° 5 107802..108027 224 N° 6 108314..108438 123 N° 7 108767..108839 71 N° 8 109248..109451 202
join(104163..104414,105015..105185,105538..105658,107127..107223,107802..108027, 108314..108438,108767..108839,109248..109451)


exon

Literature and cross-references EsilAOX01 (Esi_0071_0022)
Protein ref. GenBank:   CBJ27424.1
DNA ref. GenBank:   FN648938.1 (104163..109451)
Protein sequence: EsilAOX01 (Esi_0071_0022)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   422
PWM (Da):   %s   46730.71  
PI (pH):   %s   8.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRGTTSRLALRLTPEFRRQLATGMVISCDNHQHRFFSSSSEAADDANRQLGGTVRTTRREFATKKEIGKGLEEEKIRPGDRSQVHFRATPTKHPLGMGSPKNSSVSSEGGGRSSGGKGK
KGKEWSMPHEIWSAEEVNSIK
PTHKDPEEAVDHIALRGVRALRWFFDVLAGFKTGVIDEHKYLNRVIFLETVAGIPGMVAGTLRHLTSLRRMRRDHGWIHTLLEEAENERMHLLTFLKLK
QPGPVFRFAVMISQGVMYNAFFLSYLISPKACHRFVGYIEEEAVHTYT
LLEDIDANKLPLFSNLPAPAMAKSYWKLGDDAMFRDLVLAVRADEANHCVVNHTFADMHQEFKQDVNPFSIH
ASVTKYADAGVTPPTVADIANGDADDIAAGNTNGRSTDVNPASSQPQPQKPQPQPQAGRA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACGCGGAACGACGAGTCGCTTGGCTCTGCGGCTAACCCCTGAGTTCCGCCGCCAGCTCGCCACCGGGATGGTGATATCCTGCGACAATCATCAGCACCGTTTTTTCTCTTCCTCG
TCCGAAGCTGCTGACGACGCGAATCGGCAACTCGGCGGGACAGTCAGGACCACGCGGAGGGAATTCGCAACAAAGAAGGAAATCGGGAAGGGCTTGGAGGAGGAGAAGATTCGACCTGGA
GATCGCTCTCAG
AGGTATCGACAACATGAATCCATTACCACCAGCCGTTGCGGGGTTTCAGCGGGTTTTTGCTTGCAGACCACATCCACCTCTCCTTGTACAAATATTGTGTGATACGAA
GCGCGCGCGGATGTGTAAGGGAGGCCGCATCCCTGCCTGGTGCTCCTTCAGATTCCACTCTGGCGAGTACAGACCAAGCATGGGTCACTATTCAAAGCAGGTTCTAGCTCGTCTCTCGAG
AGCAGTATTTCTATACTACGGAAGTCTCAACATTCGACGAAACATTTCACTCCGAACCGAACGTATGCATGGGTTACCAAAGACGGAGCGTTTTGTTAACGGCCTCAGACCCACGCAGCT
AAAGCACCCGCTCGAGCAGTCGCAGATGGCACAGCGCAAAAGAACACGGAAAACGAAAGCTCAGACCAACCGCCAAACAATGCACATCATCAAAATCATTCACATCAAGTTCTGCTGGGG
TAATTTTTTTTGTGCACGGTGAAACGAGGAGGCGGTACTGCTGTGTAATGCGCAGGTGGGCCAGTATGGATTCGACATCTTGTGTGTCAATGTTAAATCACCTGTGTGCCCTTTAACATC
GGGCAAACCCACAGGTTCACTTCAGGGCGACGCCCACGAAACACCCGCTCGGCATGGGCTCGCCCAAGAACAGCAGCGTTTCGAGCGAAGGCGGTGGCCGCAGCAGCGGCGGGAAAGGGA
AGAAGGGGAAGGAGTGGTCCATGCCTCACGAGATCTGGTCGGCCGAAGAGGTCAATAGCATTAAG
AGGTGAGACGGAGAGAGGTCGGAAGACGGGGGACAGGGCCGATAGGCAGCAGACG
GGAGGGACGACACACGTTCGACGAAATTCTACCAACTTTTGGCTAAATATATAGAAGTATTGCGTCCCCAAACCTGAAAATCCAAACCTGTGAAGATCCAAAATACAAAACGGAACCAAC
AACATACCTACCCTATACTGTATATAGATTGCTGCTCTGGAAGAGTGTTGGTCATCATGTTTCGCGACGAGCTTTTTGCTGTGGCAGCTGGCCGCTCTGGGAACGAGGAAACGGAAACGA
AACGACCAGGGCCTCTAACCCGCGACCGTTCCTCGGACATCGCACATTCGCCGAAACAGCCGACCCACAAGGACCCGGAGGAGGCCGTGGACCATATCGCGCTCCGCGGGGTGAGGGCTC
TGCGCTGGTTCTTTGACGTGCTGGCCGGCTTCAAGACGGGCGTCATCGACGAGCATAAAT
ATGTGAGTTCGCAACAGTAGTTCAGCTCAAAGTCAATTCTGAGTTCTTGCGGTCAGGCAA
TCCAGAAGTGACACCCGTGAAGAGCGGGTATGCAACACCCTACAAAGAGTGTACGCGGTGTGTGACCACCGTGTGTGCGTCACACACCTCGGCCTTATCACAGGGGTTTACGATTGTTTG
TTCCAAGCCCTCCGTGGTTTTCGAGAACAATCCCACCGTCGACGTCATAACAATCCGGCTTAGCAGACCCGACAACCACATACATACCACAAGGGGGAACGCAATAAACCAGAACGCTTG
TGCTTCCGAGAGACCATTAATATCCTGCCTCTTCGCTCCTTGACTTCACTACCGCAGCCATCGAGTTGCTGTGAAGTATATTCGCAAAAAACAACAAGAGACCTCAGGCGAAAAAAAACT
TCCCACCCAACAAGGGTCAGGTCTGCGGGGCCCCTGTCTTCTGCTGGCACGGTGTCTCGCGCTGGTCGGCAAAGCAGCCACAGCTACCCCGTGGTGCGTGGAACCGAACGACTGACGGGG
GCGGAACACGCCGCGTTTCTCCGGCTCTCCATGCACGACGGAGAGCTCTGACCGCCTTGTACTTCCGACGGGGACATCTGCTCCAGTCGGACACACGGCCGGCCACCGCAGTAGATAGGT
CCTCGGGCGGGATGGGGGCAGCTTGTAGTAACTAGTGTCAGCAATAAGGCATGTGAAGAAAAACGAAACTGAGCTATATAGTAGGTTAAACGAACACCCCCCTCTCCGAGACCTACGCGC
GTGTACCTACACGAGCCCGGGTGTTTTATTGTCGCCGTGCTTCTTGCGAGTGGTGCTCCCGCTTCCGGGCATGAAACTGAGAACCGCAACCCCCCCCGCTCGAAACACCCTTCCATACTC
CGGACATTATGAGCCCCAGACGGCGTATTCTCGGGCGACAACGGTGGTGCGCGATGATGTTTCATGCAGTCAAACCTGTACAGGGCAGTGCTTCTGAATAGGGTTAGCATTCCGAGCTCG
ACGACCTTCTGTGTGACCTGCTGACGCGTGCAAGACCCCCCTTCCACCAGGGCGGTATGTCGCCGCACCCCAACCCCAAGTGGTGTATTCTCTGTCTCTCTCTCGCGATTCATGTACCGA
TTCTTTGTGGCCTCTCCGGCAGGCGAAAACCTCGAACCCCCCCCACCCACCCCACCCCGGGCCGGCGAAAACCCGGAATTTCGCTCTTTCCCGGCGTTGTAGGGATGCGGGGCTAATGGC
CTCACGACTACGGCATGCATTTGCATGAGTTGACCCCTCCCGCTCTTCGTGCCCGTCGTCATCTGCATCGCTCGCGTTCTCCTGTCCCTTCGTGTTGAACTGTGGACCCCCACTGCCTCA
TTCACCCCCCACCGCTCCCGTTCTTAGCGCGCCGCTTGGTTTCTCCTGTCCAATCATGTTGACCCTTGTTTGTTTCCTTGTGTGTAACAGACCTGAACCGCGTCATCTTCCTCGAGACGG
TGGCGGGCATCCCCGGAATGGTCGCGGGCACGCTCCGGCACCTCACATCCCTCCGCCGCATGCGCAG
AGGTACAGCGTGCTCTCGTGCGTGCGGGTACTCGGAATGCCTGTTTGTGTGTT
GTTGTTGTCTTTGCATCTTGTGTGTATTTGTGTTTTTGGCGTTGCCGCCCGGCTGCCCAATCGGAAGAAGTAGACAGCTCCACAGAAGAAATCAACGTACCGGCAGGGGATACGTTGTTT
GATGATTCGACGGGATCCCTGACCGCGGAGAAGGCTGACCACCAGAGCTCCAGTTAGTCCCAGGGGTCAAAACGCACAGATGGCTCGCGGAAGGTGTCTTCCCAACTTTGTCACTCTCTT
CCACACGCTCTATTTTTTTAGCTACTCATTAGTCTCGACGGCGAACAAACAGAGAGAGGGGTTTTCATCGAAAGCGGATCTCCTGGGGCTGTGCCTACGCAAAGAGAGTCAGGTTGTCAC
GAAAAAATACCAGGCAGGGGTCACGCAGACCGTATCCCCAACCCCAACCCGAACTCCAACCCCAACATACCCGAATCTATACTTCATTCAGTATGTGTGCTCTACGGGATATCTTTTTCT
ACCGTACGTGCTGCTGTGGCACCTCACACCGGCAAACGTGCGCGCAGGGACCACGGGTGGATCCACACGCTGCTGGAGGAGGCCGAGAATGAGCGGATGCACCTGCTGACCTTCCTCAAG
CTCAAGCAGCCCGGCCCTGTCTTCCGCTTCGCGGTGATGATCTCCCAGGGGGTCATGTACAACGCCTTCTTTTTGTCGTACCTCATCAGTCCCAAGGCTTGCCACCGTTTCGTGGGCTAC
ATCGAGGAGGAGGCCGTGCACACCTACACGGTG
TGGTAAGGGGTCATTAACCACATCCATCCGTTGTGGTAGTAGCTGCCGATGGCCAGTCGTTCCTTCCTACTCAGCGAAAGGTGGATC
AATTTTCTTTTCCCTATCCTATCTATCCCGAGGAGGATCGGGGGTTTTGGACTCGCCGATCCTTGCGTTGTAACGGGTGCGTATGCTGCCGGCTATCAAAAACGTCGTCCATGCCTTGTA
CCACGTGGAATGCGCTTGTGTGTGTCGAGCATCAAACCCACGGCCAACACAAACGCACGAATCTCTGTCTCTCATCCACAGCTGCTGGAGGACATCGACGCCAACAAGCTCCCTCTGTTC
AGCAACCTGCCGGCGCCGGCCATGGCCAAGAGCTACTGGAAGCTAGGGGATGACGCCATGTTCCGGGACCTCGTGTTGGCCGTCAG
AGGTAAACAATAGCCTACCTCATTAGTTCGGAAC
ATGGCTGACGGGACCAGATGCCACAGGCATAGGGCCATGTGCACTAGTCGTTGGTTCTGCACACCACTTTAGGCGCGTGTGTCACGCGGACCGAATGCCGCACAGAAAAAAGTGCCGCAT
GATGCGCGCTGTGTTGTTGGTTCTGTTCCCTGCCCTGACGGACGTCTTAACTCCATGTAGAAAATTTAACTTGCTGCTGCTGTCAGTGCTACTACTGGTGGTGGTGGTAACGCTTGAAGC
TTAATGCCCCTGCTATTTCCCTGCGTCGTGCTATGCCCTTCTTTCTTGTCGAAAAGGGCGGACGAGGCCAACCACTGCGTCGTCAACCACACCTTCGCCGACATGCACCAGGAGTTCAAG
CAGGATGCG
CGGTGAGCTACATGCATGCTACCAACGCCCAGCTCCCGCCCCCCGATCTTGCGATTGGTGCCTTCCCCTTGCTGGTCTCGTCCTTTTGGTTTCTTTCGACCAGGCAAACCA
ATGCGGAATCGAACCTTCGGCCTACGGGTCGTCTGTTGTTCATCGGATCGTCTCTCTTTCGTTTTCTGCCTTGAAAGCGTTGGAGTGTACGAATCATTCGTCTTACCGTGTTACCCTTCC
GGCAGGAAACCCCCGCCCGAGGCAGCCTCTACCGTGGACGTTCCCTCCGCGGTAGCGTCATCTTATCCAAACGTCTACGTTCCCAACATGTTTCACTTGTGGCATGGTATGCCTTGTCCT
CGGGTCTTACGTTCCCAACGTCTGTCGCTCGTGGCATACACTATGCCTTCTCCGCGCAGGTCAACCCTTTTAGCATCCACGCGAGCGTTACCAAGTACGCGGACGCGGGCGTAACGCCGC
CGACGGTGGCGGACATCGCCAACGGTGACGCCGACGACATCGCGGCCGGCAACACTAACGGGAGGAGCACAGACGTTAACCCCGCTTCCTCGCAGCCGCAGCCGCAGAAGCCTCAGCCAC
AACCTCAGGCGGGAAGAGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACGCGGAACGACGAGTCGCTTGGCTCTGCGGCTAACCCCTGAGTTCCGCCGCCAGCTCGCCACCGGGATGGTGATATCCTGCGACAATCATCAGCACCGTTTTTTCTCTTCCTCG
TCCGAAGCTGCTGACGACGCGAATCGGCAACTCGGCGGGACAGTCAGGACCACGCGGAGGGAATTCGCAACAAAGAAGGAAATCGGGAAGGGCTTGGAGGAGGAGAAGATTCGACCTGGA
GATCGCTCTCAG
GTTCACTTCAGGGCGACGCCCACGAAACACCCGCTCGGCATGGGCTCGCCCAAGAACAGCAGCGTTTCGAGCGAAGGCGGTGGCCGCAGCAGCGGCGGGAAAGGGAAG
AAGGGGAAGGAGTGGTCCATGCCTCACGAGATCTGGTCGGCCGAAGAGGTCAATAGCATTAAG
CCGACCCACAAGGACCCGGAGGAGGCCGTGGACCATATCGCGCTCCGCGGGGTGAGG
GCTCTGCGCTGGTTCTTTGACGTGCTGGCCGGCTTCAAGACGGGCGTCATCGACGAGCATAAAT
ACCTGAACCGCGTCATCTTCCTCGAGACGGTGGCGGGCATCCCCGGAATGGTCGCG
GGCACGCTCCGGCACCTCACATCCCTCCGCCGCATGCGCAG
GGACCACGGGTGGATCCACACGCTGCTGGAGGAGGCCGAGAATGAGCGGATGCACCTGCTGACCTTCCTCAAGCTCAAG
CAGCCCGGCCCTGTCTTCCGCTTCGCGGTGATGATCTCCCAGGGGGTCATGTACAACGCCTTCTTTTTGTCGTACCTCATCAGTCCCAAGGCTTGCCACCGTTTCGTGGGCTACATCGAG
GAGGAGGCCGTGCACACCTACACGGTG
CTGCTGGAGGACATCGACGCCAACAAGCTCCCTCTGTTCAGCAACCTGCCGGCGCCGGCCATGGCCAAGAGCTACTGGAAGCTAGGGGATGAC
GCCATGTTCCGGGACCTCGTGTTGGCCGTCAG
GGCGGACGAGGCCAACCACTGCGTCGTCAACCACACCTTCGCCGACATGCACCAGGAGTTCAAGCAGGATGCGGTCAACCCTTTTAGC
ATCCACGCGAGCGTTACCAAGTACGCGGACGCGGGCGTAACGCCGCCGACGGTGGCGGACATCGCCAACGGTGACGCCGACGACATCGCGGCCGGCAACACTAACGGGAGGAGCACAGAC
GTTAACCCCGCTTCCTCGCAGCCGCAGCCGCAGAAGCCTCAGCCACAACCTCAGGCGGGAAGAGCCTGA

Retrieve as FASTA