Entry information : EsilMDAR01 (Esi_0039_0037)
Entry ID 16938
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilMDAR01 (Esi_0039_0037)
Name (synonym) EsilMDAR01 (Esi_0039_0037)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR002]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilMDAR01
start..stop
S start..stop
EsilMDAR02 181 4.44e-51 90..383 51..374
ThasMDAR03 164 1.16e-44 37..529 27..422
LeMDAR03 158 5.48e-43 3..522 2..422
HaMDAR02 155 1.02e-41 35..517 25..409
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16938' 'complement(join(180069..180140,182430..182501,183387..183540,184461..184631,185457..185650,186982..187068,188064..188168,188634..188733,189781..189837,190662..190936,192040..192136,192422..192477,193041..193216,195375..195429))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 195375..195429 53 N° 2 193041..193216 174 N° 3 192422..192477 54 N° 4 192040..192136 95
N° 5 190662..190936 273 N° 6 189781..189837 55 N° 7 188634..188733 98 N° 8 188064..188168 103
N° 9 186982..187068 85 N° 10 185457..185650 192 N° 11 184461..184631 169 N° 12 183387..183540 152
N° 13 182430..182501 70 N° 14 180069..180140 70  
complement(join(180069..180140,182430..182501,183387..183540,184461..184631,1854 57..185650,186982..187068,188064..188168,188634..188733,189781..189837,190662..1 90936,192040..192136,192422..192477,193041..193216,195375..195429))


exon

Literature and cross-references EsilMDAR01 (Esi_0039_0037)
Protein ref. GenBank:   CBJ48589.1
DNA ref. GenBank:   FN648586.1 (195429..180069)
Protein sequence: EsilMDAR01 (Esi_0039_0037)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   556 (324)
PWM (Da):   %s   59945.61 (34409.4)  
PI (pH):   %s   5.19 (6.03) Peptide Signal:   %s   cut: 34 range:34-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASEQMFDMVCLGGGVSAGYWAEEVVSLLKSGAEQPGFNRPKLCVVTGYPDG
/span>LVPYERSEMSKECLRPENNHSRDW
AWGNKVFPFTSTGNDRERRNARWYRDNGVTVLSSCECYEVDVANATLRLYPKRLQGDQDSACFCVRHSDLRGPKLDKPEAYGLGSAHYLRDVGDCIKLVKAL
STVPSGGGAGGGTGDANTVALVGGGVLCMEVAAAIVTHY
PGVRPILLMSGSRLMPDFFNQEMSDFYEEKLKQAGVRLEKNVTAERLWGLEEGEFDTLGGRRVHFGPAPRGFTECRGVVLR
NTEDCL
IHVPARSVIIGIGAVPNSELFRGKLEMSEDGGVLVDAQCRTAVQPPSEDGGGGGIDVGSAAPPRPIYAAGDVAAFPLALEGFAPVRHEHIQNARDMAICAARNMVGSSAWGSLV
SSAGEAGFQKDYYGGGELPMYQPVPGFSSRFLGLSW
RFYGVAEGEVVVLGAAEFRTTRTFGAFWVRKERVVGAFLEGGTIEQQIAVAVTRLRPKVFSSQLLKGSQLGDFLEDPGSIEASD
ETDLSQLLMCCRCV*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGAGCAGATGTTCGACATGGTGTGCTTAGGGGGAGGCGTGTCCGCAGGTGAGTTTGCGAGCTTCTGCCTTCATGGTGTCCCGTGACGAGCCCGATATCATGCCTGGACCCAG
AGAAAGTGCTCTATTTTTCCCTCTCTTTTCAAATGATGCGATCCGACAAGCTGCCCGCTCTCTGTGCAACAAGGTGTTTAGTTGCTCTTGGCAATAGCAGGGCCAACCTAACGGCTGCGC
CTGTGTAGGTGTGTTCATGTTTGCTTCGCCCCGCGCATGAAACTCATGAATAACGGGTGTATGTGCGAGCGCGACTTGCTGCATCGTGAGTATGCAATAGGCGTATCAGCGCAATGATCG
GACCGTTACCCCCAGGATTCCTGTCGTGTGTGGTATCTGCCCAACAGAAGTTTAGGCTAGAATGACTGCTGTAGACAATACCAGCATGCAGCCTGTGGCGGGCCGCAAACGATCACATCT
GGTTTTGGTCCCCAGCCGTCGATCTATTTGGCCATAAATTGATCTTGCTTCGATTACTTGCCCAACAAGGGAAAACATATACCATGAACTTTGTATCTCGAACAACAGCAGCAGTTCAAG
CCGGGCGACATGTCCTGTAGAACATACCATTCACGATCAGAGGCTGATTCCGCCGTCGGCGCATACGACAGACTTTCATTGAGAACGATGGTTGCATCAGGATGGCATGCATGCATACTC
CTACAGTAGTAGGGGGCCCGCATTAATGCCGCCTATATACTATTTGGAGGTTGTTGTCGTTGCTGTCTCTTCATCAAAAACCGTTCCGATCTCTCAACCCAGTACATCCATCTGTCCGTA
CTGATCAAGCGCGTCACTGAGCGATTCCCGTGGTCACATGATAACTTACCTAAAATAGGTAAACTCACATAAAATGGACCCACCCGCCGCAGGATTTTACCGGCCTTAATCAGGCACCCG
GCACTTTTCAGAGTATCGGACAACTTGAATTATTCTGTCTGTGCCAACCGATTTCACCGCGTTTGTATCGAGCGACCGACCTTATACAGGCCCCTACTGGTTTTTGTACTCCTCGACTCT
ATTTGTTGAGCGGTGGGCGGATTTAGAATTTGGTCAACCGGGATGCGTCGGCAGACAGCCGTGCTTGAAAATTACACATTCCGCACCCCTCGCTCGCCGGACTTGCCGGACTTGAAGTCA
CAAAGATGCCGGGGAACTGTCTTCTTTTCACAAAGATGACGGGGAACTTTCTTCTTTCACAAAGATGCGGGGGAACTGTCTTCTTTTCACAAAGATGCCGGGGAACTGTCTTGTTTTCTC
GCTGAGCCCGAAGCGCTGAACCTGTCGTTTCGGGTCATGCATCACTGGGATTACTACACAGACTGTTAACTCATATAGCCGCTTGCCGTAGTCAGTCAACCGTAACCATATGGTAGACCT
TGCATCCCCACAATGCCACAGCGGCTTGGGCGAGCTTACCGCTATTTTTGGATGAGTTTGAATCAGACGGGGGGGGGTTGACCACGCCCATATCTATGCGTGCGCTACCCGGGCAACACT
CTCAAGGGCTGTGGTTTGAGCTACTGCTGTAGTCAAGCGTTTTTACTCAAGGCTGCTTCTGCTGCAAACGAGATCATCGTCTCGCGTCTTTATCTCGTCGGAATTGTAGTTCATCTGCCA
ACCGGGGAGCTATGTATGTGCTCCATCTGTACGACCCCATCAGTCTGCCTGTGATTGCTTTGCGTTTGTATTGATTTTCTGGGTCCTTCTCATCGCATGCACCACGCTGTTACTCGAAGC
GGTTAGCCAGAGACCATGAAAGTCATCCGCGTCACTTAGACCGATGCGCATCCCAAAATGTACCTACAGTACAACGGGTTTTTATATTGCGCAGAGAACAACGATGTTGACCCTACCTGG
TGTGTGGCGAACAACGCGATTGAAGACACATCACTACCGCCGTGTCGATGGCGGTGGAAGAGGCGAGGGCAGGGGCAGGGGCGAGGATGGCCCTGGTACTGCCGGCAGCGCTGGCGCGCT
TGGGTACTCCACTTCCTCTTGCCCCCCTTGGCGGGCACTGAAAACACCTCTCCGACCTCCACCTCAATCATGGTTACATACATACCCACAGCACGATTCACTCTCAGCCAGCCGTGTCAC
AGCAGTATCAACAACGCTACAAACCTCCGCCCCTTGTTCGGCTGAACGGTCAGGGGGTACTGGGCGGAAGAGGTGGTTTCGCTCCTCAAGTCGGGGGCGGAGCAACCGGGCTTCAATCGG
CCGAAGCTGTGCGTCGTGACCGGGTACCCCGATGGCCTTGTCCCGTACGAGCGGTCGGAGATGTCCAAGGAGTGCCTCCGGCCCGAGAACAATCATTCCAGAGACTGGCAG
GTGCTATTG
TGGTAGTGCTTTTACAACTCGATGATGTCTCTTTTGAGAGGTTTGACATGGACAGACAGGTGCTATTATGTAGTGCCTTCACAATTTGGTATGATCACTTGTGAGTCTTGTTGACTGGCA
GTTCCTGGTGCTTTCACAACTCGGTGATGCCTCTTTTGAGAGGTTTGACATGGACAGACAGGTGCTATTATGTAGTGCTTTCACAGCTTGATGACGACTATTTTGGAAGGTTGGACATGA
CTGCTGGCAGATGCTACTGATAGTGCTTTCACGTCTCGATACGTCTTGACATGACTGCTGGTAGGTGCTAGCGCTTTCACAGCTTGATGAGTCACGACTGACAGGTGCGAGTATATAGTG
CCTTCACAATTTGGTGCGATCACTTGTGAGTCTTGTTGACTGGCAGTTCCTAGTGCTTTCACAAGTCGGTGATGACTCTTTTTAGAGGTTGACATGACTGCGCCACGGCGGTTAGTTAAC
CTCGTTTGAATCGCCAACTCCCTACCTCGCACTCTCTCTCTGTGCTGTTTTATGTGGACCGTGACGTTTACCAGGCGCGTGGGGAAACAAGGTCTTCCCTTTCACCAGCACGGGGAACGA
CCGAGAGCGAAG
GTGCGTGTGCTCCCCTCACCCCCTCCTGTTGATGCAATGACTCTTTAACAATGGCGGTCGAAAGCCCTTGGTTCGTGTGTACACTCGGAGGAAAGAGAGTGCTGCACT
CTTCGGAGAGTAAACAATCGAAGGCAAGCGTGAAAGAGAGAATAATCATCCTCGACAGACGTTGGGGAGACTTGACCTTTTATGAGGGTGGTCTCTACACAAGCACCGGTTCTGAATCCC
GAATCTTGTTGGGGGGGTGTCCTATGCTTCGCGTGTGCGTGATCGTGACTGGCGCAGGAGAACGCTCGGTGGTACCGGGACAACGGGGTTACGGTCCTGTCGTCTTGCGAGTGCTACGAG
GTGGACGTGGCGAACGCGACGCTCCGACTGTACCAG
GTGATGAGCTAGCTCCTCGGTTCCCCTGCCGCCGCCGCCCCGCTGCCACGAATCTTGATGCTTCGGTTGCCTTGGGAGCCGAGA
TATCTACGTTGTCCTGGAACTCCCTCCCTCTCCCGGTTTCTGTCTGTCTGTGCCCCTCTCTCTCGCGCGCTCTCGCTCTTTTCTCTCTCGCTCTCTCTCTAGATGTACACATGGTATATA
CATTTCCTTCTCTCTCTCCGTCTTGCTCTCAATTACCGTCTGCAACTGTCGCTTTTCTTCTTGTCCCTCTCTCTCGTCCGCTCCGCTATCCCTACACAGTACTCGGACCGGGCACGCACT
AGGGCAAAGGCGAAGCAGCTGTCAGTCACGTACGGCTCCCTGATTGTAGCCACCGGCTCTGCGGTACGTGTGTCGTGCTCGTCTTGTCGTTTCTCATGGTCGGGGGTGGTGGTCTTCTAG
AGCCGTTCAACACAGGGAGGACACGTTGTGTGGTGCTGTCACCAAAGAGTGTTACACTATTATGCCATGTGGAATTAGGTTTCTTACGGTATGTATTGGTACAATACGCAGAATTCTCAT
CTCGAGTTGTAACTGACGCCGTCCGAACTCAGCTTTCTTGTACATCGACCGCGTCTGCGGCGAGGGGCTGTCTCCATCCCAACCCCACCCTACGAGCAATGTTTGGCTTGCCCCGGTTCC
GTTTCCCCTGTCCGACATGTGGTACGTTTTTTTATGTTTGTCGCTCCGCTGTTACCCGACCGCCACGTCCTACTTGTACCCCGAGGGGAAGGGCGTGTTTCGAGACACCGCACTTTTCTC
TCGCTGGTTGGGGTGATGGGGTGGCGATTTTTGGGAGTTGTATTTTCCATTCCAACTACTTCCGGGCGAGGGTGTCCACGCTTGCTCAACCCGCTCCCACCCACCCCCTTCCGTTTCTCA
TCCGCTCGGTACCGGCTTTCTCCAATCAAATCCTGTTTTTCAACGAGACACGAAATATTATGTTTTATTGTAGATATTTGGGGTGTTGTTTATTTCCTGGTTTTGGCAGGGCATGTCCAT
CCCATTCCAATCCGTTCCAACCCCAAACCCCACCCCAACTCCGACTACGCGAAACCCAGCCCCTAAGCGCTTGCAGGGGGACCAAGACAGCGCGTGCTTCTGCGTGAGACATTCAGACCT
ACGGGGCCCAAAGCTCGACAAGCCGGAGGCGTACGGGCTGGGCAGCGCCCACTACCTTAGGGACGTCGGCGACTGCATCAAGCTCGTGAAGGCGCTGAGCACGGTGCCCTCGGGGGGGGG
CGCGGGGGGGGGGACGGGGGACGCGAACACGGTTGCGCTGGTGGGGGGTGGGGTGTTGTGTATGGAGGTGGCCGCGGCGATCGTGACTCATTACCC
GTGAGTTTATGTGTGTGTGTACCC
TTTTTTGGCGCCTACCGCGACTGTGCTGACCAATGAGAGCAAGTCAGCGGGCCAATATAATGTTTCAAAGAATGTCCGCCTCCCATGATGTGCACATGTGTGCACACGCTATGTGTTTAT
TTGTGATTTGCATGGACCGCACTACATGTAGCCGGCTGACCAATGAAAAGACGTCAGTGCGACTGGAAACTGCTAAAGGGCCATGATGGGGGACCCCATGAGGGGGTGCGTCGACGGGTG
TGTTGTGTGTGCGTTTTTGTTCGCACATCTATCGTGGTTGCCATCCCTTTGGCGTCTTCCGGTTGGTCGGTGACGCTTGCGCTTAGACATGTTTGTTTTTCCCGTGCTGACCACAGGCTA
TAAGACCCTAATAGTGTTCTTCCGGGTGGGCGTTGTTATTGCTGCGCGTGCCGCGTTTCACGAAACGAAGTGCTCAAACCATACCCCTTCGCATTTTCCGTGTTGGTAGTCTGTTGGGAC
CTCGCTCGCAGTACCTACGTAAATTCCCGCGCATGTTGCAGCGTTCCTTAGCTGCCGCTCTTGTCGATGAGTCAGGCGAACGTGTCCATCCCGAAAACGATACGTTATGTTGTCATGTAC
ACACAACACTGATGCTCGCCGGAAGAAAACAAGCTGTACTTGGTCCCTTCCCTCCCGTCCCCAGCCCAAGAACATCGATCCATCGTAAGGTTTCACGGAGCCGGGGATCAGAGAGCGATA
CACATTATAGGGAAAATCTTAATCTTTCCCCTTCCCTGCTGTGTGTGCTCTGTTCTGATGCCTTGACGTTGCTCTGTCAGGGGGGGGTACGACCGATCCTGCTCATGTCCGGGTCGCGTC
TTATGCCGGACTTCTTCAA
GTGAGCCGTCGAAAAAATCTTTCTTGCATTACAGTGGGGGGCCCGGTGTAGCGACCCCTAGTGTCACGACGAAACGTGGCCGCTATTCGGGGCAGGTCGCT
CAACCAAACTACCAATAATGTAGCAGCAGTTACACTATCGGGGTCCGGCTGTGCGACGTTGTTTTGTGGTCGCTACAGAGGGCATGTCGCTTAACAGCGGGTCGCTAAACCGGCCCATTT
AATGAGAAACACACTCTCACGAGAAAACTAGGCTCAGGTTTTATAGATTCTTAGAACCATGAAAGGAAAATGGCGCGAAAAAAAAATTGAGCTCAGCCGCCGGCACTTGCACGAAATCCT
GTTCGGAGCTCGCTAGTTTTGGTCTATATGCTTTTTCGTTGAGACTACTGTACCGTATCGAAAAGCCTGCTTTCGGCCCAGGAAGGAGGCGTGTTTTCTTATCCTGTTAGCGCATGTCCC
GACTCAAGGGTCATGCTGTGTGTGCAGCGGTGTCACGTGGTTGTCCGATTCGTGCTTCCGAATTCACAAAGGAATTCATGACAGCAGGAATGAAATTATCTATATATTTCCACGCACTCC
GTGACGATGTCACTCCGGTAATTGCATGGGAATGTTATCGATGCCTTTACGCACGTGCGGTGTGCTGCTCCTTGCAGCCCTTGTCGCTTCCAAGCGTTTTTATGTCGGCGAGCTTCCGAT
TCCGGTGCTCGTGTTGTTTGCTCGCCTGGAGGAGCTTTTTTTTTTTTCTTGTCGTCACTTCAACTCTTTACTCATAACACTTGTGTCGTTTACTCCAACCTATAATAGCATGCGTTCCCC
TCTTCGTTTTGATACAAACAAACTGACCAGCTTGCACTCGTGGTTGTTTGTTTTTGTTTTGTGTGTGAGGGTCCCTGTTGTACCCAGTCTATTCCGGGGGCAGTCTACGCGTTTCCGTAT
GCTCCGGAGTGTGTTGGCGCGCTAGCCGGGGAAACACAGGCAGTGTCATTACAGCGTGCACGATACGTTTTCCGCTCAATTTTAATATTGCTGTTCCTGTTGTCAGTCTCAGGAGATGTC
TGATTTCTACGAGGAGAAGCTGAAGCAAGCCGGCGTTCGTCTCGAGAAGAACGTCACCGCGGAGCGGCTATGGGGGTTGGAGGAGCAG
GCAAGGACCCCATTCGTTTGGCAGACACAGCA
GTCTGCTGCGATTATAGTGGACATTTGTTGTCGTGTTTATGTTATGCTAGGCACAAGGACGGGTTAGTTATTAGTGGTGGTGCTTGTGACATGGGGCTATGCATATGTTGGTACTGTTTT
AGGGGATACGATCTCCATCTCAGGTGTTTTTAGTTCGCTCTGGCATACAGTATATACTCTGCGCAGTACAATCCCACAACTCTCTCGCTACACCAAGCGCCCTACTTACTCCTACCCTCT
TTCATCAGCAGGCCAGCCTTGGCTCAGCCACTCTCTGCCTCTGCATTTGATCCGAAGGCATTCCATCACTTCTGTGAATTTTCATTCCCGTAGCACCGCCGACAACGATAGCCGGCAATT
GCCCCTCTCATGTTTGCATTGGTGGGGTCCGTTTGATTGCCCCGCATATGTTTTGGTGGTGTTTGTTTTGCAGGGGGGGAGTTCGATACCCTGGGAGGCCGCAGGGTGCACTTCGGCCCC
GCGCCCCGGGGGTTCACGGAGTGCCGAGGAGTCGTCCTGCGCAATACCGAAGATTGCTTG
GTGAGGTTTTTTTTTTCGTCCTGTTTTTTATGGCGCTCTGTATTCATGGGCAAATCGCCC
CGAAGGCAACAACCCTGGTAGGAAGCGTTGTCGAAAAGAAAGCCCACCTACCACGACCGCCAAACACGATTGATGTATATGGTTCCGGCATTTTCCCTCGCTATATTGTATTTATGCGTG
AATCACCCCAAGGCGACAACCCTGGTAGGTGGCGCTGTTGGGCGACAGTCCCCTCATTTTTCGTGGTGAGACGTGTACTACACATGTTTCAGTTTATGTATAGAATATTACACTCTTCAA
TATTTTTTGTACAACCACAACCTCCGGGGTTTTTGCGTTTTGGAAGAAGTTTAGGATCCAAGCAGCGCCCGTGTTGAAGATGAACTTGCGCAGAGTTCCGCGCATGTATCCACGAATGAC
TGACAGTAGTGGCGGTAGTGCCTCCCATGGGGGGGGGTGGCGGGGGGGGGCACGCAGAAAGTATTCTTTGTAGTGATATGGAGGCTCCGTGTATACGGTCAGTCTCCGGGGAAGAGAATG
AGTGAGAAATGAACTGAGTGCTTTGGCTTTCGCTCGTACGAACGTTGAGTTATATACGACGAGCCCAGTTCCAGTTTGAAGGTCTTGGGGGGGTTGAGCAACGGCGGTGTTCCCTACAGC
AGCCGGTGCCATGAGTTCTGCCCACACACACCCCTCCGCCTAGGGGGCTGAAAAGGCGGGAAGTGGCATCGATGGGATAGGTAGGATAGGGAAACCCTTTTTGAGCCACCTTTGGCATAG
TAGGAAGGAACGATTGGCCATCGATCCTGTGGGAACAAAGCTCCGTCGTTTCGAGGACGCGTGGTCAATATTATGAAAACAAAGGCATGAGAAACATGAGTGCAAAACATAAGTACGCCG
TCCCCCCTCCCGCCTTCAGTGCAAGGTCGCTGTCGACGCTTATTGGTTAAGTCTTCCAGGCCTCACAACCGTCTTTGAAAACACACGCGACGCAGATATCCATGTCCCTGCCCGCTCTGT
CATCATCGGCATCGGCGCGGTGCCTAACTCGGAGTTATTTCGGGGGAAGCTCGAGATGTCCGAG
GTGAGTCCGGAGGGGGGGACGGGAGTGACGGTTGGTTCTCGTGCGATTATATTGCA
AGTACTGGGAAAGTTAGCCTGCGACCACGGGAATCGACCCCGTCAAGTGTTAGACTACAATAGTGCAGACAGAAGAAGGTACTAGGTAGAGAGAACGGAACGGTTTTTAGTGTGAAGACA
ACAACAACAACAACAATAACAACAACAACAACAACAACTGCTGCAGCAGAGCCATTGGCGATAGTTGGATTGTGTTTGGGATGTGATTGATCGCATGTGTTGTTGTTCCGGGTTCCTAAT
CGATCGGCATTGACGTAGCCACGATTCTTCTTTGCTCTTGGACCCGTTTTCGGAGGAGAAGCTGGAGGCGTCGGAGGAATTGGTAGGGGAGAGATTGGTGTGTTGAGAAGTGTTTCGCAG
CATGCCTTTACCGTGACGTCATATTTTATCCGCAATCCGCTCGTAAGAGCCAAACCAGGTACACTGGGGGTCTCGGTATAGCGACCACAAAATCACGTGGCACCGCCGCACCCAGGTTAC
AAGTGCTATATGATTGTTAGGTCGGTTTAGAAACCTTCCTTGAATAGCGGCGAAATTTCGTCGTGACACTAGGGGTCGCTAAACCCGCCCCCCCCACTGTATAGATGTGTTTGTTGCCGA
GGTAGAGGCGCTGGTTTCTCGACCCTCACCATCACCGTCGTGCTACAAGTTGCTAAGATATGTAGCCTGCCGTTTTCTGACATGACTTGAGTACTTCGATTGTGCAATGATAGGTTTTGT
TATTTTTTTCTGTCCATGTGCTTCTCCACCTGCCCGTCATCCATAGATGGTGGTAGCAAATTGATGAGCGGTAGGGAGCTGACAAGACGAGCACAGCAGAGTCGCACGCTGCCCCCCCCC
CCCTCCCCGTGCTGTTTACCACCAGGGTCCTACCGGTTACGACTGACATATCACAGGTCACGGTTGTGAAAAGTTCCCAGCGCGGCCCAACAAACACGTCACAAGATAACACACGCTTAT
TTCTGTAGATACCACCCCTCCCCACACACAAGTGTACATCCAACCGGTGGTAGCATTTCTTGCGGGTCACCTTGAGCCCACACCATGAGGCTACTCTTGATGAAGAGTTGGCCTCTACCC
GTTTCGACTGACGTAGGCTGCGGTTGTCTACAAAGCACGTTGCGAGGTCTACGGTACGGGAGACTGTACCAAAAAACACCACACACGCCGCGCGCCTGAACACGCTCCCCACACTTGCCA
AGTGTTTCAAACGTTCAAGTTTTGATTTTTGTTGGTCTCTCGTTGGTTCGTGTGCTCGCCGTCGCCGCCTCCAAGGAGACGGAGGCGTTCTGGTTGACGCCCAGTGCCGTACGGCGGTAC
AGCCCCCTTCCGAAGACGGGGGCGGCGGCGGCATTGATGTCGGTAGCGCTGCTCCCCCCCGGCCTATCTACGCGGCCGGGGACGTGGCGGCGTTTCCGCTGGCGCTGGAGGGCTTCGCTC
CTGTGAGACACGAGCACATCCAGAACGCCAG
GTGGGCGGGGGATTGACCCCGAGAGCACGGGTGAACCGTATACAGGTTTTACCAGGAAACATATATATACAAACACCGAGAGACTACCC
GTTCCAGATGTAACCACAGTCGAACGGGGTGTGTTTGGAGTTTTTGCAGTGAGTGGAGGGAAACCGGCTGGGTACTGCGCTTATTTCGAGTCTGGTTTTTGCCTAGGCACTGATTATTTA
TATCAGTGATACCAGCTTCAAAAGTATCTGAATAGGTTTTGTACAAAACTACATCCCCTGTAGTTCTCTACTGTATTTTTTTTTTTTTTTTTCGTTTGTTGGGGTCAGCTGGGCTGTTCG
AGAGAGGTGCGGTTGACAGTACCTACTCCTGTTTGCAAAGCTTGGTTGCTCTACAGAAAAACGGTGGCGGTGGCGGTGTTGGAAGAGGGCGGCGTCGGGCCCTCTCTCTCTCGCCGATAC
TGTCCCGAACTTCTCATCGTTCGACTGCATCATCCTCTCTTGTGGTGGGTTGCCGTGTACGACACAAGATAACACACCCCCTGGACCGATTTTCAAAGCTCGATTACTCCACGACGAAAA
CGATGCATATACGAAACGATACGTTTTCGGAGAGCTCTCGACCAGACGGCTTTTCAACGGCGCCGTGTTGGACGCTGCGACTCTTTCTGCTGTTGATGAATCGAGCATTGAAAATCGGTC
CAGGGGGTGTGCTATCTTGTGTCGTATACGGTAATCGGGTTTTGGAAGTCGGTCCAGGGGGTGTGGTATCATACGCGACCTACATTACATTCTTTTTTCACCCGTGCTCCCCGCTTTTTC
CTGCCACGCCGTTCAGGGGGACATGGCTATCTGTGCCGCGAGAAATATGGTCGGAAGTTCCGCGTGGGGAAGCCTGGTTTCGAGCGCTGGGGAAGCGGGGTTCCAGAAGGACTACTACGG
CGGCGGGGAGCTTCCCATGTATCAGCCCGTTCCGGGCTTTTCGTCCCGGTTCCTGGGTCTCAGCTGGAG
GTGTGACTGTCTGTTGTGAGACTATGCTTCAGAGAAGCAAGAGCTGGTCGC
CCCGGGGGTGTATTGTGGTTATCTGACGGCGTTGTTGTTGTTGTTGTTGTTGTCTTCACATTTTAAACCGTTCCGTCGTAAACGTACTAAGTAGTACAAAGCGATTCTCTCTCTGGAGTG
AAGAAAAAAATTGCAAGTTGCGGTGGAAAATGGTGGGTAAGCACGTTACTGCTTCACGGTCGATTAGCGAAAAGGGTGGCCGAACCCCTGTCTGGATGAAATCAAGGCAAGCACCGCAGG
AGGGAGGTGGGGCATATCTCTACATGTGTCCAGAACTCGTGTGTGACCTCCCGTGTTTGTGACCCCGACTGATTCGTCAATCATGTACACCGATTGGTGTGTAGACTTACGCCAGAATGG
GTGAGGAAGACAACACACACATTTTTTTTTCTTTTTGTCAAGGGGAAGAAAACGGTGTGTTTTACCAGTGTGTTTAGTTCTGTCTTGTTACACGACGGGAAACAAGGCATGCGGTCGCCG
GTAACAAAAGTATTTTCATTTTGTTGTCTCCTCCCACATCCGCACCTCCAAGATAAAAAAAACTTGTTCGCCATGTTACCTCGTACAGCAGGCGCCGTTCTCCACCACCGTCCATCAATA
TCCTGGCATTTTTCACTTTCCATACACCACGGGAATCGACCGTCAAGTGTTAGACTACAGCGGACAAGAGAAGGTCTCTGGGCAGAGAGAACGGAACGGTTTTTAATGTGCAGACAGCAA
CAACAACAACAACAACAACAACAACAACAACAACAACAACAATACATACCCCGTCACCCCCCTTCCTTTGGTATGTTTTCACTTCACCACGGCACGTAAACACGACGCTTCCTCCGTCTC
CGCGTGCTTGGACGTAAATTTCCGAGAAGATATTCTACGGCGTGGCGGAGGGGGAGGTGGTGGTCCTCGGGGCGGCGGAATTCCGAACGACACGGACGTTCGGGGCTTTCTGGGTCCGGA
AGGAGAGAGTGGTGGGCGCTTTCCTGGAGGGGGGAACCATCGAGCAACAGATAGCTGTGGCACAG
GTGCGTCGTGGGTAACGAAGAAGGGTGCGTATTTGGCGTACTGCTACTCTGCGGC
GGCAGGCCTTTGCCGCCTAGCCTTAAGGGCCGTTTGTACTCAGCGTTTTGCTTCCAAATTTTCCGAATTTCCAAATTCCGACTTTCCAGATTTCCATTTTTTTTCGAAGCATGTTGGAAC
GAGCTCATCCCAATTTTTTCGGTGCTGCCAAAGTTTCCAATATTTTTTCCTCTGCCGCAAATCGAGGTTCAACGGTCAACGGATTCGGAAACTTGGAAAAGGAAGCACAATCACTGCGTA
TAAAACGGCCCTTGTGTGACGTCACGTTGGTTGGGCCGCCGGGAGTAGCTGGGTTCTGCGAGTGCAGCACCGCTAGGCGATTGCATGCAGGATATGAAAGTGTTTCAGCGTGATTCTGCC
AGTGCAGCACCGCTCGGCGATTGCATGCAGGAAAGGAAAGCGCCTCATGTTCCGTGTGCAAGGAGATAGAAATGGTACTCTAGGCGCTTGCCTATTGGGGGTACCGTGGAAGACCTGTGT
TGCGCAGCTCCGTTGGTCGTCGGCATCCGCAGTGGAGAGTTTTTTTTTTCCGCGTTAGCACCACTCCGGTACATCCGGCGGAGATAATATCCCCCTCAGGCACAGTACCACAGGAGGGGA
GGGTAGGGTGAAACCCTTCTGAGTGACCACGGGTTGGAGTAAAAGGCACAAGTGCTGCAAGCTCTGATTTGAAGTCAAGACCAGCAAATCCCCGTGGTTTCAGTTGATCCGTACAGGCGC
GCATGAGCAAGCACCGAAGACTCCGGCGACTTTAGTTCGGTTTGAGCCACATGCATGATGAACACGGCCGTGCTTCATTCACTGCATTCCGTGCTATAAACGATATGCAGGTGTGACCCG
TCTTCGACCCAAGGTGTTTTCCTCACAACTCCTCAAAGGCTCCCAGCTCGGCGATTTCCTGGAG
GTGCGTCGTTTGAGGCTTTCGGCGTCTGTCGGGTTGTTGCCGTTGCTTTCTCGTGG
TGCAGATACACGGGACGGGACGCATTCCAGGGTTTCGGTGCACGTCGCGTTTTGGGTGTGGTTTCCTCGTGGTGCAGATTAATGGGACGGGACGCATTCCAGGGTTTCGGTGTACGTCGC
GTTTTGGGTGTGGTTTCCTCGTTGTGCAGATTAATGGGACGCATGGTATGTCGCGTTTACGGTGTGGTTTTCTCGTGGTCCGGATTAACGGAACGCCCGCTCCAGCGGAGAGGTTGCCGT
CCTCAGCTGTCCCGGGGCCCCGTCAATGTGATTTTTGCTTCAACTTTTTTTTTTCACAGTTCAACCTTGTAGATAAGGAAACCTTGGCGGTGCCGCCCCCGACTGCTGTAAGCTTCCAAC
CCTCCCCTCTAGCCTTCAAAGACACCAAAACCTCGACATGTGCTTTTTAGCAACCTTATACGAGCTTAGGCAACGCCGTTTGCTACAACTGTGCCGCTGATCAGTTTAGGCGTTTAGGGC
GAGATCTGGTTGCTTGAAGCTTACGTTACGAGCACACTCTTTCCGAAGAGAATGTTTGGTGAACAAGGCCAGCAACACGTGCTCCAGTTGCCGACAGCGACAGCTCAGCACAACAACCAC
CCTGCTGGAAATCGCCAGAGCCTACCGATGTGATGTGCTAGTGGAGTCGCATGCCTTGGCAGCAGCAGCAGGCAACCAAAAACCAAAAACGGCGCTGCAGGTTTTCCTGTGAACTGTATG
TAGATGCATGGAGTAGCCCGAATGGTACCAAACTGCCGGATATTCTGGGTACGTTGAAACATCGCCGCGTTCTCCACGTGAGTTTCCCCGATGAACAACCGGATTGAACGCGCATCAAGA
TGATTTTACCTGGCATGGCCCTACTATTATAGGCCAAAAACATGGAGAGTTGAGACTGGGCACATTTTGATTTTTCGATCTACGGTCCAATATAGTACGAAATAAATACTCATACTTCGC
AGTGAAAAGACGCCCAATGTAAAACTCCATTTGTGCAAATCCGTAACTCCACGTTCAAGTTTTTTTTTTTTGCGAAATGCCCTTCCTTTTTGGCTCTATCGTGTTGTGGTGAGGAGCATT
GCGTAGCCTTGAGGCGGCAGCAGTGTTCAACTGCTCCCGCTCATCTCTCCTTTGACCGGCAACCGCCGTTTCCCAAAACCATCACGCGGAGGTGTTGGCGTTCATTTCTCGCTCCACGGC
AGTTCGGACAGCCGACACGATCCGACGTTCATTTGTGTCTGTTGCTGCAGCCATAGGTGCTATTGCGGCAGCAACAGGTGACCTATGGCTGTGCAGCATTAGACCCTTGGTCGATGAGCA
TCGCATCGTGTCGGCTGTTCGAACTGTGAAGCGGGAAATTAAGGCCGAACGCCTTCCCGCGTGAGGGTTTGTGAAACACCGGGATTTGGGGCAAATAGTTGTGAGCAATCGAGAACAAGC
CGCCGTTTCCGAAACCTCACCAAGACGGTGTCGGGGTTCATTGCCCGCTTTCACGGGTCGGATGCCCATTACGATGTGGCGCATGCAGACGAAGGGCCTATCGCTGCAGCAATAGGAACA
CAGTAGGGCCTATTTTGCTGCCAGCACTAGGCCCTCGTCTGCATTCGTGGCCGCGTGATGGAACGCCGACTTGTGAAGCGAGTGATGAAGACCATCGCCTTTTCCGCGTGAGGTTTTGAG
GAAAGGTGGGTTTGAGGAAAGAGAGGCGAGCAGTCGATCATAGACCGCCGTTTCCCCGACCGTCACGAGGAAGGTACCGGTCTTGAATGCTCTCTTCACCGTTGCATTAGCCCACGCGAT
GCGGCGCATGCAGACGGGGGCCTATTGCTCCCGCAATCGACGTAGAGTCTATTGCTGGCAGCACTAGACCCTCGTCTGCGTGCGCCGCATCGCGTGGACTAATGCAACTGTGAAGCGGAT
ATTGAAAACCGATACCTTCTGCGTGAGGGTTTTGGAAACGGCGGATTTGCGGCAAAAGCAGGTGAGCAATCGATTATTTTATGACATGGGTCGCAGAGAGGTTGGTATCTAGACCCACAG
ACGTTGCCGCGTGCACGTTTGTAGTTGGGGCAGACAACCAAACGATTTGGGACATTTGTGTTATCCCGTAGCGATCGGCGGGCCATGAAGTTGCTGCTAATGCCTTGCGCTTGGGCACCC
GTCGCGCTCGCCCCCTTTCCCACCTTTCTTCCCATTGTGTCTGGCGCCCGACCCATGTCGTGCGGCTACGCAGGAGACCCCGGCAGCATCGAGGCATCCGACGAGACGGATCTGTCGCAG
CTCCTTATGTGCTGCCGCTGCGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGAGCAGATGTTCGACATGGTGTGCTTAGGGGGAGGCGTGTCCGCAGGGTACTGGGCGGAAGAGGTGGTTTCGCTCCTCAAGTCGGGGGCGGAGCAACCGGGCTTCAATCGG
CCGAAGCTGTGCGTCGTGACCGGGTACCCCGATGGCCTTGTCCCGTACGAGCGGTCGGAGATGTCCAAGGAGTGCCTCCGGCCCGAGAACAATCATTCCAGAGACTGGCAG
GCGTGGGGA
AACAAGGTCTTCCCTTTCACCAGCACGGGGAACGACCGAGAGCGAAG
GAACGCTCGGTGGTACCGGGACAACGGGGTTACGGTCCTGTCGTCTTGCGAGTGCTACGAGGTGGACGTGGCG
AACGCGACGCTCCGACTGTACCAG
CCTAAGCGCTTGCAGGGGGACCAAGACAGCGCGTGCTTCTGCGTGAGACATTCAGACCTACGGGGCCCAAAGCTCGACAAGCCGGAGGCGTACGGG
CTGGGCAGCGCCCACTACCTTAGGGACGTCGGCGACTGCATCAAGCTCGTGAAGGCGCTGAGCACGGTGCCCTCGGGGGGGGGCGCGGGGGGGGGGACGGGGGACGCGAACACGGTTGCG
CTGGTGGGGGGTGGGGTGTTGTGTATGGAGGTGGCCGCGGCGATCGTGACTCATTACCC
GGGGGTACGACCGATCCTGCTCATGTCCGGGTCGCGTCTTATGCCGGACTTCTTCAATCAG
GAGATGTCTGATTTCTACGAGGAGAAGCTGAAGCAAGCCGGCGTTCGTCTCGAGAAGAACGTCACCGCGGAGCGGCTATGGGGGTTGGAGGAGCAG
GGGGAGTTCGATACCCTGGGAGGC
CGCAGGGTGCACTTCGGCCCCGCGCCCCGGGGGTTCACGGAGTGCCGAGGAGTCGTCCTGCGCAATACCGAAGATTGCTTG
ATCCATGTCCCTGCCCGCTCTGTCATCATCGGCATCGGC
GCGGTGCCTAACTCGGAGTTATTTCGGGGGAAGCTCGAGATGTCCGAG
GACGGAGGCGTTCTGGTTGACGCCCAGTGCCGTACGGCGGTACAGCCCCCTTCCGAAGACGGGGGCGGCGGC
GGCATTGATGTCGGTAGCGCTGCTCCCCCCCGGCCTATCTACGCGGCCGGGGACGTGGCGGCGTTTCCGCTGGCGCTGGAGGGCTTCGCTCCTGTGAGACACGAGCACATCCAGAACGCC
AG
GGACATGGCTATCTGTGCCGCGAGAAATATGGTCGGAAGTTCCGCGTGGGGAAGCCTGGTTTCGAGCGCTGGGGAAGCGGGGTTCCAGAAGGACTACTACGGCGGCGGGGAGCTTCCC
ATGTATCAGCCCGTTCCGGGCTTTTCGTCCCGGTTCCTGGGTCTCAGCTGGAG
ATTCTACGGCGTGGCGGAGGGGGAGGTGGTGGTCCTCGGGGCGGCGGAATTCCGAACGACACGGACG
TTCGGGGCTTTCTGGGTCCGGAAGGAGAGAGTGGTGGGCGCTTTCCTGGAGGGGGGAACCATCGAGCAACAGATAGCTGTGGCACAG
GTGACCCGTCTTCGACCCAAGGTGTTTTCCTCA
CAACTCCTCAAAGGCTCCCAGCTCGGCGATTTCCTGGAG
GACCCCGGCAGCATCGAGGCATCCGACGAGACGGATCTGTCGCAGCTCCTTATGTGCTGCCGCTGCGTTTAG

Retrieve as FASTA