Entry information : EsilGOX02 (Esi_0070_0142)
Entry ID 16941
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilGOX02 (Esi_0070_0142)
Name (synonym) EsilGOX02 (Esi_0070_0142)
Class Glycolate Oxidase     [Orthogroup: GOX001]*
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilGOX02
start..stop
S start..stop
BstrGOX03 337 2.6e-114 17..374 5..358
HaGOX09 337 2.62e-114 17..374 5..358
PpaGOX01 335 1.2e-113 10..368 1..354
AtGOX05 334 1.8e-113 20..368 8..351
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16941' 'complement(join(675249..675326,675617..675747,676193..676286,676789..676920,677617..677677,677938..678002,678433..678565,679440..679572,679879..679941,680638..680772,681151..681213,683069..683141))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 683069..683141 71 N° 2 681151..681213 61 N° 3 680638..680772 133 N° 4 679879..679941 61
N° 5 679440..679572 131 N° 6 678433..678565 131 N° 7 677938..678002 63 N° 8 677617..677677 59
N° 9 676789..676920 130 N° 10 676193..676286 92 N° 11 675617..675747 129 N° 12 675249..675326 76
complement(join(675249..675326,675617..675747,676193..676286,676789..676920,6776 17..677677,677938..678002,678433..678565,679440..679572,679879..679941,680638..6 80772,681151..681213,683069..683141))


exon

Literature and cross-references EsilGOX02 (Esi_0070_0142)
Protein ref. GenBank:   CBN75171.1
DNA ref. GenBank:   FN648927.1 (683141..675249)
Protein sequence: EsilGOX02 (Esi_0070_0142)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   386 (203)
PWM (Da):   %s   41859.52 (22706.4)  
PI (pH):   %s   7 (3.73) Peptide Signal:   %s   cut: 27 range:27-229
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSPEKKVPVDLSRCISLDDFQRQAKPILGKALYEYVASGTDDEQTLSENRQAFKRMFLLPRMMRVVSDIDLRLDVFGQRLSMPVFVSPAGVHKLMHPEGECATARACAEAGTLMGVSQHATVSLEDVAAAAPRCARWFQLYILKDRELTAGILRRSEKAGYTAI
CLTVDSVRFGSREADWRNNFNGLPPGVTLANYPT
DGYNDRVKDAWDQNTEKLFDERATWSDIAWLKSLTSLPILVGILTAQDAVSAVEAGASGVIVSNHGGRALDGSLSSIESLAPVVKA
VRSVPTGANVPIFLDSGVRRGTDVLKALAL
GATAVLLGRPMFFSLAVGGQEGVQRMLSIIRDELEAAMALCGCRLQDITKDLVTDFREGGSTFHRPRL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAGCCCCGAGAAGAAGGTGCCTGTTGATCTTTCGAGGTGTATCAGCTTGGACGACTTCCAACGACAAGGTTAGCCAAACATGTCTCCATAATACAATTCCGAGAACGGATCTTTG
GTGTCACGGCGCCCGCGGATGCTTCCTTTCCCCTCCAACTGCGCGAACAACAGCCAACCATGTACCATTTTGAAAGCGTTTTGAAAGCTGCCTCAACTATTGATTGTATCACGTAATGAA
GTCTGTGGTCGCGGGCTTTGATGCGTGTGTGGTGGTACTCGGTCCGGCTGGGTGTACGTACGTATTGTACATGCAAGTTGAACACCGCTCAATACTGTGCGGTACCCGTAAACAGCTACT
ATATGTACAATTGTATACAACTTTTGATAAACGCACCCAGCAAACCTAACAGCGGCAGCAGTTCTTTGTTGTGCCCACAAGAGCAACACAAGCACAGCGTCCCGGTAATCCACCGCAGAC
ATCGGGGGTGACACAGCAACCCAGTCATCGGAGAAATCCTCTGTAGGGTAGAACAAGTACCATGTAGACTCTGTTTGTTTTCGTGGAATCATTGGCGCCTCGTTGTGTGCGTGTGGCGTA
TGGAAGTTCAGTCCCTTCCCTCGAGTCTTACTTGTAATTCCTAACTCTGTCGCGCTCTCTATGCATAAAAACACGAAGTAAATTTCTTTGAACTCCCACAACAACCCAATGCATGCAACG
CAAGCCCGTGCTCGTGTAAGGCAGGTCCGCCGCTGCCTGTTTTGTTCCTGCGATGCTGCTGACTCGAACTATTTTTAATTTTTCGACGCAACGAATCCATCGATATTAAGACATAATTAT
TATATGGGGGTGTTTGATTTAATTAATTGTTTTTGGGTTTTGGGGAGCATATAGACTATGTAGCGGCGAGAAACGAGATAGTCTACGAGACGCGGAACCACATCTCGACGGGATTCCATT
TCCCAACCTAGCCGGCAGCCGCAAGAAAGCTTGTTTGGGAGATTACTGCCACAGACAAATTAACACCAGTTCAGTGCGGGCCACTACCGTAGCTTGGCTCTCCTAAGCGAGATGACTCGC
CAAAGTTTTTGCCATCAACAACGTGCTTTTCGACTCTTCCCCTGAGCACGTAAGTTAGAGGCACGACTGCGGAGGTCTAGCTACACTTGTTCGTGACTATTTAAGTCTAACCGATGTTGC
ACTTTGCAAGGCTAGTTTCCTCACGCGAGCAAGGCTAGGTTCCTCACCCTACATCTACCCTAACCCTAACGCAAGGCCAAAGCACGGCCTGGAACGGCGAGAGGGCGCTGGAGAGCGTCA
AGGCTAGGTACCAACGCCGGACCAATCAGAGGGCGTGAAACTGCTTAGATAGGAAGAGTGACTGTTTAACAGGTTGCAAAATTACTGGCGGAACCAACCCTTTGGTTTTCCTAAAGCTTC
GTGGGCGTCGGTACACTGCTGTGTTGTTCCAAAAACCTTCGAGTCTACTTGATTGGTGGAGTATCGGAACAACCGGACTACTGCCTGGTATTGATTCTCGAGGCGGGACCGGAGCTTGTG
ATGCGCTCCACCCACACGGTCACAAAAGGCGTTAGTTGTGGTGCCTGCTTCAGTAATCGCTTCGTTTGATCTGCAAGGTCTTCAGACCTAGCGAGAAAAAGTGGGGGGAAGGGAGGGAAA
CAGGCGGCCCACCAGGCTCAACGCTATCCAGTGTTGCCACGTTGTAGGCTACCTAGCTGTGTGCCACCGACTGCTCTCTGCGGCCTGACAGTCCCATTCCCATGCATCGCGCTGTTCCTC
GACAATCTTCGCGGCGCGGTACTATCGTGCTGCTGCTGTGCACTGTTTTTCAGACCTCACGTTGTTCGTGTTTGTCTACCCGCCCCTCATACCTGCCCCTCTGCCACTACCGGACATTGA
TGTGCCAGCGCGAAGCCTATCCTGGGGAAGGCTCTGTACGAGTACGTCGCTTCTGGCACGGACGATGAGCAAAGTAGGTGCCAAACGCACCGGCGGCGTTTAGAACTTTTGAAGCACAAC
GTACATGTACATATCCCTAGAAGTGTTGATAGTCTGTTTTCCGACCCAGCTAAACAGCCTCGCGACGGCCTGTGTTTCCATTACCGTCGCGTTTTGACGCTCCTGTGTAGGCCAGTGGTT
GAGTGGTGGCGGTCAGAATCGACTCATATGTGGCACTCGCACCAACAGGCATAGTTATTGACTCATAAAAACATGTTTGCTTGAAACGGCATCTCCTACGGCCGCCATCACCTATTTAGT
ACTGCTGCCCACAGCCCACTCGAAGAGCGGCTGAGATGAGATATGTGATGTTTCACCAATTCTTCTTTTTCATACCCCGAAAATCACGCAGCGCGCTATCGGAGAACCGCCAAGCTTTCA
AGCGCATGTTCTTGCTGCCGCGCATGATGCGAGTCGTGTCCGACATTGACCTGCGGCTCGATGTTTTCGGGCAGCGGTTGTCGATGCCGGTTTTCGTGTCGCCGGCCG
GTAAGTGCGTGT
ATTTGGACGGGGGGGGGGGGCAGCATACTTGCTTCGGAACAGAACCTCTGAAACTGTTTCTTCTGGATTGGAGGTGTCCTGATGGGGAAAATATAGCGTCGGTGTAAGTTTTTCTTTCGT
TTGAAGGGGGATGGCCGACGGTCTCAAGACGTGCGCACAAGTTGTTGTCGTTGTTGTTCTCGGCGATAAACGAGTACGGCGCGATAGAATGCAAAGGGTGGAACATTCCCTCACCCCCAA
TCCCCTCAACGTTTTCCTCGTTCTCTCTCACATCGGCTCTTCTCTCGCCCCCCTTTTTCTGTTCTTGTCTTGTGGACTGCTTCATCTCTGCTACTGTTTATAAGGTCAATGAAGTATGTT
CTTTTCGAATGTAAGGGCAAACACTTGCCGTCTGGAAAGCTAGCTTTTCTTCCTCGCAGCAGTTGGCGGACGCGCGCACGGCGGGAGGCGGGCCCTATGGGGGGCACCTACGGCGCGGTT
GCAGACCTACTCGTTTAATGCATGCCGTTAATTTCAAGCTTGGAGGTGGGCGCCACCGGTGTCAACGGTAGTTCCGTGCTCGGACTTATTTGTGTTAAGCGCTTCTTGTGTTCCACCTCC
ACCACATTACCAGGACAATGGTAACCTGAACCTTGTTGGTCGCTCCCGACTGTGGGCCGCTGCACTGTCCTACACGCGTTGCAGGCGCGTGCACAAGCTCATGCACCCCGAGGGGGAATG
CGCGACGGCGAGAGCTTGCGCTGAAGCCG
GTGAGACAGATGACAAACCCCCCACTTACTTGTTTTTCGGGAAGCACCTCCAGCACAAAGCGTGTCGTGCACTTCACGTGATTGTTGCTTC
GGGATCGACCCCAACGCGTGGACCGTTACAGGTTGAACTGACCTGAAACGTAGATCCGAACGGCGACTTGGTGGAGAGATGTCAAGCATGGAGATGGTCCTCAAATACCGAGAATAGCTA
TTACTGCTGTTGTAGTCAACTACACTTACTGGTACTGTATTCTAGTAAACTTGTTCCTGGGCCTTTCTTCGGTCTCTACCGTTGGATTGACGCAGGTGTACCCTCATGGGGGTCTCCCAG
CACGCCACGGTGTCGTTGGAAGATGTGGCGGCCGCGGCTCCGCGGTGTGCCCGGTGGTTTCAGCTGTACATCCTGAAGGACAGGGAATTGACGGCCGGCATATTGCGGAG
GTTCGTACGT
GCAAGCACGCCGGGAGTGCCTGCAGCGAGAATTAACACGATAGCCGGTGACTTGAATGGAAACGGGCGCAAGTCTCGGGGCAACAGTTGAAGGTAGACCTCGGTCTGTGCTCAGAGAAGT
CGTGATGTTTGTTCGGGTGAAAACGAAGGAGAGCTACGAAAAGTATCACTCATCCGGACAAAACTTCCGTTGACTGAACTGCGATGTACCAAAACGAGATTATGCTTTTTGTTTCGGGAT
GACACACTTTGACTTTCTTGATCGTACAGGCATAGACGTGTGTTTGCCGTATGTTAGCAGCGTATTTCTCGTGTTGGTTGCGGGTGCATGTCTCGGCAAGGTGTCTTTCAGTTCAAGAAA
GACAATAATTGTCGTCGTTCCACAAGAATGGAACCAACACAACGGGGGAGATGATACGATCATGGAATGTACAGGTAAGGATGACGGATTGAAGAGGAGCGAAAGAGGATCTGACCTTCG
AACCCAACAGAAACCCCGAAAGCTCTCATCATAGCGTTGCGATCGTGTCTGAGGTACTTTTGGCAGCGTGCGGTACGCCGGGGGGAGCGATTGTTGCCACTTGTGTTGTTGCGCTGCGTA
GACGGACACTAGGTCTTGGTCGGTTGTTGCATTGATAAAGAACTGGTTCCGATAGTTTCTTGGCATCCTTCATGGAACGCACAATGAGTCTGACTGCTCATGAAGTGCAGTTTGTACGTG
TCATCTACTGGGTAGCCTCGCAACCACCGCATCAATGGCGGTGCCAACCATAGTGACCGCAACAACACCGGTTCAAAACACCTGTTTCTAGACTGCAAGTGAAAGCAAAATCAAAAGCAA
ATCTGGAACTACTTTGTCCACCAGGTGTCCGAAAAAGCTGGCTACACGGCGATTTGCCTGACGGTTGACAGCGTGAGATTTGGGTCAAGAGAGGCAGACTGGCGCAATAACTTCAACGGG
CTCCCACCAGGAGTCACGTTGGCCAACTACCCGACGCAG
GTGTGCACCGAAAAAGGAATCATCCCAGAACTTCGATCCCGATGTCGAAGCCCTTGCAATTTTCGTTTGGTATTGTGGTGC
CTCTCTCCTCACCCTGCGAAACAGCCCGCGCTAGTCAAGAACTATCCCGGCAGAGTTGGCTGGCGCCGCAAAAGGGTTGGTTGAGCCTTTGAAGAACCACAAGCACTTACTGCTGTTCAA
TCCACCTACGCCCTTCAATCAGTGTTACGAATGGCGAGGCATCTTGGTGTCTCGATACACGTCGTTGGTTCCCTTTTTCCTTTTTTCGTCAACATTTGTTTTGGTTCGTGCTTTCAGCTG
TCGCTTCCTAGTCAGGTTTGTTCTTTGGTCGCCTAACTTGCGACATCCCTTCCCCGCGAAACGACACCTTCCCTCCGAATAACGTCAAATCTCTCCGGGGAAAACTAAGGAGACGGCTAT
AACGACAGGGTCAAGGACGCGTGGGACCAAAACACGGAGAAGCTGTTCGACGAAAG
GTAAGCCTTGCCGAAAGCAGCCGCTGTTCTGATGCCAACTTGCTTGTGTGTGTGTGGACCGCAG
AACTCTTCGCCTTCCAGCTTTCTGCCAGCGGACTTCAGCAATATCCACATGTGCGCTTGAAGTTGGCCGGGGGCGATGAGTTCGTCGATTGTTCCGAAGGGTATTGCCCCCATGCCCGAT
GTAACTCAGAGGAATATGTCGTGCCACTCTCCTCCATGCCTCGTTTCTCGTTCTTTGTCCCGCTTGGCGTCGGAAGAGAGCTACCTGGTCGGACATCGCTTGGTTGAAGTCGCTCACGTC
GCTGCCGATTCTGGTCAAG
GTGACGTCACCTACACGTATGGGTCGAGAGTACAACATACGCCATGAATTTGCCTCACTATTAGGCGACCCAGGCGGTCAACAGCAGCAGGGTTGATGAAA
TAGCTCATCTGCCTAGAACTGGTGGAGGGGGGTGTATCGCCAAGCGCGTTGGAAAGCACACCCAGGAGCCAATTCTGCCCGCGAACGCTTGCCGCTCTTGCTCTCTCTCACGTGCGTTGT
GATGACAAACCAACGGAGACAGCCAACATCTTTGAGCAACACATCAAGCAGCAATGTCAGGACCGCAGAAATGGTTGGGAGGTTTTAGACCTGTCTCATGGACAAATTTCATCCGATACA
TTTTGTTTTTCTTCCTGGCCTAAACAGTGCAAGACGGGGTGTGGCTTTCGTGTTTACCCGAAGATTTTGTCCCAAAGACAACTCACAGTTGCACGGCACGCTTCGTTGGGTTAATGAAGG
GGTGGGTAACTCAACGAGGCGGGGGAAAATTCTACGCAGATTTCGGTGTTCCCACAAGCACTTCAGCACTTGGGCGTTGGTAGGGAAACTCCTTTCGCACAATGGGTCAAACAACAGGTG
TAATATTCCCTCAACACTTCACTGCTGTCCCCTCATTCTCAACTCGACCGACCCCAAATTCCTGTCTTGTCCTTCATACCTCTGTGTTGTTGTGCTTCCTATGTGCTTCCTACAGGGGGG
ATTCTGACCGCCCAAGATGCCGTTTCGGCTGTTGAAGCCGGCGCAAGCGGGGTAATCGTTAGCAACCACGGGGGGCGCGCACTGGACGGATCGTTGTCTTCGATCGAGAGCCTCGCCCCG
GTGGTCAAG
GTGAACTTGTCGATACCATCTGTGAACCGCATGCGAAAACTTTGGCAAATTCCACGCGCATGATGTCGGGGGGGCCGTGCTTCGGATACCGGTATTGTTTCTGTCGCGCGC
CGAGACCGGGTTGAACTTCACAAGAAGGCCACAGGTTCGGACTACATTGTCGGCTTGAGCCTACCCTACTAGTAGGACCTCGTGGCAAGCCAAGCTAGTAGTTGTACCAGGTATATACTT
CTGCCCGATTGTGGTTTCTTACAATCTGTCAGCTGTCCCGAAAAGCATGCTTGTTTGCGCTTTGTTGCATACCACGTGGCAGTCGGGTTTCTTTTGATTCGGTGAGGCTGGTGTCACGTA
AACGAGTGTCCGTGCTGTTGTGTGCCGCTCCTGCCACGGGCTTCGTGCATTGGGCGCGCCGGACAGGACCTCCTGTAGTACTGTCGAGTACTGTCGATGGGCAAGCAACGTACCTCCCCA
CCATTCCTGACGTGCGTCTTGAACCTCGCAGGCGCGGTGCGGTCCGTCCCGACGGGTGCAAACGTCCCGATATTCTTGGACTCGGGCGTGCGCAGGGGAACCGATGTCCTCAAAGCGCTG
GCGCTAG
GTACGTCTTAGTCGGCGGTGGCGGCGGCCCTAGCTCAATCCACCACAACAACCTCGAACCCGGACCTATTTTGCCAGCTTGTAAAATTTCGATGCATCTCGCACCTCACCAAT
TGGTGTAGAGAAATGCCAGTAACACAACAGAGGCAACGAAGCAGTTGATCGTTTTCGTGTCGAAGACTGCCTTTGGGATACAGCTTTAACTGCCTAGTTCACGTCTGGCCTGTTACATGT
GCACGCTAAGGGCGTGTGTATTTGTCTGTTATACTAAACCTTAGGCCATGGCTGTTTCGCCACTGGAACCGTTGTGTTCTTACCCCCTCCCTACTTCTCTCGGCTCGCATGTACGCCACC
GATTTCGCCTGTTTCCGCAATTCTCTTTTCTGGTTTTCTCTCTTTTCCTTTGATCCCCCTTCCCCCTCAACCCCCCGTACGCCCCACCCTAGGCGCGCGACAGCTGTACTTCTAGGGAGG
CCCATGTTTTTCTCACTGGCTGTGGGAGGGCAGGAGGGCGTCCAGAGAATGTTGAGTATCATCAGGGACGAGCTGGAAGCCGCCATGGCGCTCTGCGGGTGCCAG
GTTCGTGGTGGAGAG
GGAGTACTTTTTCTGCATGAGCATGTCGAGAAGAGATTCTCCTTCTTGGCAAACGAAAAACTCACGTCCCATGCGCAACAACATTTGCCGTGTGTAGCGTTTACTTCAAACGCGCCAAAC
GCGCTACATCCCGCGATTCTGCGCTCTCATGGCGCTTTCAGGTTTTATGAGTTCATGGGGGCGAATTAGTTCTGGTTTCAGTTGCGCCTACGGTGACCAATGGGAAAACTCTTTTCTTTT
CTATCATCTCTGCTTCGGGCTTTGTTGTCGCGCAGAGAGGCTGCAAGATATAACGAAGGACCTAGTGACGGACTTTCGAGAGGGTGGGAGCACCTTCCATCGCCCTCGACTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAGCCCCGAGAAGAAGGTGCCTGTTGATCTTTCGAGGTGTATCAGCTTGGACGACTTCCAACGACAAGCGAAGCCTATCCTGGGGAAGGCTCTGTACGAGTACGTCGCTTCTGGC
ACGGACGATGAGCAAA
CGCTATCGGAGAACCGCCAAGCTTTCAAGCGCATGTTCTTGCTGCCGCGCATGATGCGAGTCGTGTCCGACATTGACCTGCGGCTCGATGTTTTCGGGCAGCGG
TTGTCGATGCCGGTTTTCGTGTCGCCGGCCG
GCGTGCACAAGCTCATGCACCCCGAGGGGGAATGCGCGACGGCGAGAGCTTGCGCTGAAGCCGGTACCCTCATGGGGGTCTCCCAGCAC
GCCACGGTGTCGTTGGAAGATGTGGCGGCCGCGGCTCCGCGGTGTGCCCGGTGGTTTCAGCTGTACATCCTGAAGGACAGGGAATTGACGGCCGGCATATTGCGGAG
GTCCGAAAAAGCT
GGCTACACGGCGATTTGCCTGACGGTTGACAGCGTGAGATTTGGGTCAAGAGAGGCAGACTGGCGCAATAACTTCAACGGGCTCCCACCAGGAGTCACGTTGGCCAACTACCCGACGCAG
GACGGCTATAACGACAGGGTCAAGGACGCGTGGGACCAAAACACGGAGAAGCTGTTCGACGAAAGAGCTACCTGGTCGGACATCGCTTGGTTGAAGTCGCTCACGTCGCTGCCGATTCTG
GTCAAG
GGGATTCTGACCGCCCAAGATGCCGTTTCGGCTGTTGAAGCCGGCGCAAGCGGGGTAATCGTTAGCAACCACGGGGGGCGCGCACTGGACGGATCGTTGTCTTCGATCGAGAGC
CTCGCCCCGGTGGTCAAG
GCGGTGCGGTCCGTCCCGACGGGTGCAAACGTCCCGATATTCTTGGACTCGGGCGTGCGCAGGGGAACCGATGTCCTCAAAGCGCTGGCGCTAGGCGCGACA
GCTGTACTTCTAGGGAGGCCCATGTTTTTCTCACTGGCTGTGGGAGGGCAGGAGGGCGTCCAGAGAATGTTGAGTATCATCAGGGACGAGCTGGAAGCCGCCATGGCGCTCTGCGGGTGC
CAG
AGGCTGCAAGATATAACGAAGGACCTAGTGACGGACTTTCGAGAGGGTGGGAGCACCTTCCATCGCCCTCGACTCTGA

Retrieve as FASTA