Entry information : EsilGOX03 (Esi_0017_0040)
Entry ID 16942
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilGOX03 (Esi_0017_0040)
Name (synonym) EsilGOX03 (Esi_0017_0040)
Class Glycolate Oxidase    [Orthogroup: GOX001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilGOX03
start..stop
S start..stop
EsilGOX01 431 6.54e-151 23..404 11..394
MpalGOX01 345 1.9e-117 28..404 2..369
MpGOX01 345 2.09e-117 28..404 2..369
PpaGOX01 337 5.65e-114 36..404 8..368
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16942' 'complement(join(237412..237552,237921..238061,238952..239086,239303..239392,239722..239928,240283..240455,240952..241070,241739..241871,242242..242317))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 242242..242317 74 N° 2 241739..241871 131 N° 3 240952..241070 117 N° 4 240283..240455 171
N° 5 239722..239928 205 N° 6 239303..239392 88 N° 7 238952..239086 133 N° 8 237921..238061 139
N° 9 237412..237552 139  
complement(join(237412..237552,237921..238061,238952..239086,239303..239392,2397 22..239928,240283..240455,240952..241070,241739..241871,242242..242317))


exon

Literature and cross-references EsilGOX03 (Esi_0017_0040)
Protein ref. GenBank:   CBJ25884.1
DNA ref. GenBank:   FN648214.1 (242317..237412)
Protein sequence: EsilGOX03 (Esi_0017_0040)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   404 (303)
PWM (Da):   %s   43314.29 (32279.9)  
PI (pH):   %s   9.03 (5.62) Peptide Signal:   %s   cut: 31 range:31-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRLEGQSATASAASTGMPLPTPKSDTARPGCTHVNVADYERRAKVVLPKGEFDYFAGGANDMVTLRENRAAYRRLRLRPRVLRDVSSVDTTRTVLGERMAHPIGISPAEHRAAHDDGELATARAAAGTCSMMVVSSSATTALEDVATAGGPNMQRWFQLSLSS
R
NRTVLAGLVRRAIAAGYTALVVTVDRPVLGRREADLRNCYELAPRLAEGRVVSATGARIGRRPDGTMDLGQASDARPEAGKSLNWDDVHWLRTICGDMKIVVKSVMTREAAEEALAHGV
DAVWVSNHGGRQLDTVPATIEILPE
VVQAVRGRCEIFVDGGIRRGTDVLKALALGASAVFIGRPVIWGLAHSGEHGVTDVINLLNEELVQAMRLMGCKKLGDIERSMVAHQSSYHAKL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGCTTGAAGGTCAAAGCGCTACTGCCTCTGCTGCCTCTACTGGTATGCCCCTACCAACGCCGAAGAGTGGTGAGGCTTCGGCATTAATTCTGAATAACGCTACCGTACCGCAA
GTGGTTAAACTGCGCATTCATTCGTAGAGGACCTTCGTTCTGTGTCGGCGAACGAAAGAACGGAATGAAGCGAGGACGTGTGGTTGGCGGTACTTGTCTACACTATCCTCGTTAGAGTAC
CAAACGTTTTGTTCTCAGCCATGTTGTAAACCTTACCCTGAACACACATCTGGTTGAGGAAGAAGCCATTCACGTACATAATTATATTTGCTGCATGTTGGCGGTGTACATACATGCAGT
CTACAGTACCAACGAGTGTGAGGTTCGCCGCAACTCTCGCGGTGTCGTAATGTATGCATACGCTGCTGCACGGTTCTCCCGCTAAGATATACTGCACGACCAGGATGCACGCATGTCAAC
GTTGCGGACTACGAACGACGTGCAAAGGTTGTACTGCCGAAAGGAGAGTTTGACTACTTCGCAGGCGGTGCGAACGACATGGTTACTCTCAGGGAGAACAG
GTGAGCAAGCACTGCACGC
AATGCATCCTCACGATGAATGGTACAAGTCAATTGTTCGCGCTACACATCAGGTGGCACATAGCGTGCAGCATATCTATTGTAGTCTAGCGCGCGGCAACGCAGAAAAGAGCCACCCGAA
CAATAGAAGTGACACACAGACGGACAGGCTCCTTTCCCAAACGACTACTGTAACAAAGACGTGCGATTTGTTGATGCATTTAGTTTAGGTATACAAGGACCCAAATCCAAATCCTGGAGC
TAGGGACAGAAACGAAACATGGTTTGAAGAAGTTATCCTGTTGTCGATTTTGCGCAAGAGGAACTTCTCGGGATACCGCTATTTAGAGGTGAAAACTTCGAACATGGGCTGTGTGATGGA
AGTTAAATTTCAAATCTTCCGCAACGATGGGACCAACGCGGAACATCGAGATACTGGTTACCGATCGGCGTTGTTATGAGATTGAAGACATGGACAACAACTAGCAGTCCGAGGCAACCC
GCAAGTAAGCACGGAGAACCGAAAGAGTGGTAAGTGTCGCATGAATGTGGGGGTCTATTTCCCACCCATCTCGTCCACACAGAGCCACCAAGTGGTACTATAATACTCCTACCGTTTCAC
GGCAAGGACGATAGGCGACTGGTCTCGATGTTTTTTCGCGTCGCTTCAGGGGGCTGCGTACAGGCGTCTACGGCTACGGCCTCGCGTGCTGAGAGACGTGTCTTCAGTCGACACCACACG
CACGGTGCTTGGTGAACGCATGGCGCATCCCATTGGAATCTCGCCCACAG
GTGATTAGGGGTAATAGTTTCGTCTTGCTTTTCCCGTACCATGTACCGTTGAGTTGTTTGAGAACAGTAA
AACGTGTAGACGCCGCTAGTCTAAGCTGAATACAGTGTCACCACATTCCTGCAGCAGAGCTAAATAGGTGCGACTGATAGCCACAAATTCGGTGGTAAGAGAAATAGAATGGTGCCGCAT
GGAGGTGTATGAGCGAATTAGGTGCTTCGTTTTGTCACCGAAGCCAACCACAAGGCAATTTATTTTGCCTCAGCCCTGCCAGAGACTAGCAGACGTGGTCCTTGTTCCTAGCCCTCCCTC
ACAGTACTCTTATGTGTCAATAATATGTGCATCCAATGAATACTCGCTAATCGCGCTTCTGTGTTTAAGCTCGATAAGGACTACAACATTTCCCCCCCGCGACTCCACTACGGCCACTAT
TACCATTGCCACTGCTATTGGTTCTTCGTGCTGCGCGTGCCGCTGTCTCATCACCAATGCTGCAAGCTCTGAACATCGCGCTGCCCATGACGACGGTGAGTTGGCCACGGCGAGGGCTGC
TGCCGGGACTTGTTCGATGATGGTGGTGAGCTCGTCGGCAACGACCGCCCTGGAGGATGTGGCCACCGCCGGTGGTCCCAACATGCAGCGCTGGTTTCAGCTTTCATTGTCATCGCGCAA
G
GTGCGACAAAGATTGTTCATGTTGTCGTTTGCTGTTGTTGTCTTCACATCGATAAAAAAACCGTTCCGATCTCTCTACCCGGTACCGTCATCTGTCCATACTGGTCAAACACTTGACCT
GTCGATACCACGTCTTGATAGGGCATGCAGTATGCCATCGCATTGCAGTGTTACGAGCTTTGGTGTGCTTCCTGTACCCTGATGACCAAATGTCCCTGTTCTTATACTGCACAGCCTCAG
GCAATATGCCCACTCGACGTGGCTGTTTACTCCCTGCCCCCCCCGCTCACCCCCTTCATTCGCTGTCGCCCTTTCAACATTTTGCACCACAATTTGATGATCTTTGAAACAAAAGAAAAC
AGAACAGTGCTCGCCGGGCTCGTTAGGCGAGCCATCGCGGCCGGGTACACCGCGCTTGTCGTTACCGTGGACCGCCCCGTGCTAGGCCGGAGGGAGGCGGATCTGCGGAACTGCTACGAG
TTGGCCCCTAGGCTTGCGGAGGGCCGAGTGGTATCGGCAACGGGGGCACGCATCGGTCGCCGTCCCGACGGAACCATGGACTTG
GTCAGCAAACAGTTTGTCACAGTCAAAGCTGTTGTT
CACGCCAAATAACCGGAAGCATACAAACTGCAGGTCATTTTGGATGACCGTTCCGAGCTCTGGGTCGCCTGGCGCTCTCGGAATAAGTTCAGTGTACGGCATGCCGTTGTTGTGCACGAA
TCGTGCTCCACTCTCTTACATCCCATTACCCGGGAGGGAGTGTTCTGGCACATCAGAGATAGATGTGTCCCACATTTTTTCCCTTACACTGGCAGCTAGCTGCCTGTATGATACGTTTGT
GTTCCCGTATTTGCTGTACACTGAACAGCTGCTGTTGTTCGTGGTTCTTGCAGGGGGACAGGCGTCTGACGCTCGGCCTGAAGCAGGGAAGAGTCTGAACTGGGACGACGTTCACTGGCT
GAGAACTATCTGCGGGGACATGAAG
GTATTTGCTGAACGGTTTCAGTGACCACCTGAGTTGTCATGTTGTCATGATTCCTTTTTTTTCCAAACTATCTGTAGGTTAGCTTTTGCACCGTA
TAGCTTTTGCACCGTATTTTACGTCTATCTATACGTTTTGCCCAGCCATGGCCGTTTTTGAACCGCCGAGAAACACGCCCAGTGGACGCGTGCTGAGCAGAGCATTCGTTCTTTTATCCA
GATATAGTGGTCAAGAGTGTGATGACGAGGGAAGCGGCGGAGGAGGCACTGGCGCACGGAGTGGACGCGGTGTGGGTCTCTAATCATGGAGGGCGACAGCTAGACACCGTTCCGGCCACG
ATTGAGATCCTTCCAGAG
GTGCGAGAAAGTGGGGGGCGGAAGGAGAGGATATAGATAGACGTTTCGCCCAACGCCGCGGGAGTCCCCGGTGCTGCTTCGGTGGTTACCTTCGAATGTTTA
GACAGAGCGCAGTCAGGTAGAAACCTCTTTCCCTCCAGAGTACTCACAAGAACGGGCTGACTGCCGTAATTGATGGGCCGGAACGAGTATCTCGGCGATGTGGGATAGGCTGCGAACCAT
TTTCTAACCATCCGGTACCGCGTATAGAATGACACTTGAACCATCGGGTGACTTGTGCTTATAGACGACAGTCCAGAGGGTTAAGGTGGGACATTGAAAGGATGCTGGAACGAGGGATAC
TGAGATGGCATTTCCATGCGGTTTTCATTGGGCAACGGCACCAACAGAGCGTGGCCTTGGATACAAGAAAAGTCTGACGTTCAAGACGACGTCCCCTCCGAATCCACGTCAAAAGTAAAG
CTGACTTCTGAGGTGGTATGGCTCTGTCTGTTGCTGCAGACGCGACATGGAACGGCCGCGAATTTTGATCGAATGCGTTTTCAACTATGCATGAGCACGTTGCAACGGCCAACGTGCCAC
TCGCGCGGGAAATGTTGATGTCGTCTTCACATGATCAATATTGACCTCGGATGGATCTAGTACCTGCTCGTCCATACCTTCAAAATGTATTGCCGTGGTCACAAGCTGACCCACCATAAT
AAGGAAGGTAAAAAAAAGGCAGGCGGAGAAAAGGTCGTTTTCATTTCCTCTCATGCAACACCACCATTGCCTTTTGCGCTGTAGTAGATGCCGAACGTCCAAGAGAAGAGACGTTCGCCG
ACCTTGTTACCGGCGTCGCTAGCTGAGATATTTTGCTGTGACCATTTTGTTGGCCCTTCCCTCACCAGGTGTGGTGCAAGCTGTGCGTGGACGTTGCGAAATTTTTGTGGACGGAGGTAT
CAGGCGGGGCACGGACGTGCTGAAAGCGCTTGCCCTGGGCGCATCAGCTGTTTTTATCGGCCGACCTGTCATCTGGGGGCTAGCCCACAGT
GTGAGTTTTGCGATGTACCTGTATTATTT
GTCGCCCGGCAATCATTCCGTACCAGCAAACAGCACGTTTACGCGAGATGGATGGTAAGTATTCGATCATTCCTGGTTTGTGTTAGTTTAGACGAATGCGATGCCTCTCCACGAAGAAGA
GCATGTTGGATGTTTACCGTAGTTCGGATAGTCACGGATACCGTGGCGTGTCGCGGTGCGTGTTGGCTGGGCTATCTGGAGTGACCCATCCCCATGACTACAACATGAATTTCCATAAAC
AACGTGGCAGAAAAGAACTGGTCACAGAATGATTCTCAGTCTCCTGCCTGACCACAGTACACGTCTGGTGACAATGACGCACTGCATGATGCATGCCAGGGGGCGAGCATGGAGTGACGG
ATGTCATCAACCTACTCAACGAAGAGCTCGTCCAAGCGATGCGGCTCATGGGCTGCAAAAAGCTTGGTGACATCGAGCGAAGCATGGTCGCACACCAAAGCTCCTACCACGCTAAGCTCT
AG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGCTTGAAGGTCAAAGCGCTACTGCCTCTGCTGCCTCTACTGGTATGCCCCTACCAACGCCGAAGAGTGATACTGCACGACCAGGATGCACGCATGTCAACGTTGCGGACTAC
GAACGACGTGCAAAGGTTGTACTGCCGAAAGGAGAGTTTGACTACTTCGCAGGCGGTGCGAACGACATGGTTACTCTCAGGGAGAACAG
GGCTGCGTACAGGCGTCTACGGCTACGGCCT
CGCGTGCTGAGAGACGTGTCTTCAGTCGACACCACACGCACGGTGCTTGGTGAACGCATGGCGCATCCCATTGGAATCTCGCCCACAG
CTGAACATCGCGCTGCCCATGACGACGGTGAG
TTGGCCACGGCGAGGGCTGCTGCCGGGACTTGTTCGATGATGGTGGTGAGCTCGTCGGCAACGACCGCCCTGGAGGATGTGGCCACCGCCGGTGGTCCCAACATGCAGCGCTGGTTTCAG
CTTTCATTGTCATCGCGCAAG
AACAGAACAGTGCTCGCCGGGCTCGTTAGGCGAGCCATCGCGGCCGGGTACACCGCGCTTGTCGTTACCGTGGACCGCCCCGTGCTAGGCCGGAGGGAG
GCGGATCTGCGGAACTGCTACGAGTTGGCCCCTAGGCTTGCGGAGGGCCGAGTGGTATCGGCAACGGGGGCACGCATCGGTCGCCGTCCCGACGGAACCATGGACTTG
GGACAGGCGTCT
GACGCTCGGCCTGAAGCAGGGAAGAGTCTGAACTGGGACGACGTTCACTGGCTGAGAACTATCTGCGGGGACATGAAG
ATAGTGGTCAAGAGTGTGATGACGAGGGAAGCGGCGGAGGAG
GCACTGGCGCACGGAGTGGACGCGGTGTGGGTCTCTAATCATGGAGGGCGACAGCTAGACACCGTTCCGGCCACGATTGAGATCCTTCCAGAG
GTGGTGCAAGCTGTGCGTGGACGTTGC
GAAATTTTTGTGGACGGAGGTATCAGGCGGGGCACGGACGTGCTGAAAGCGCTTGCCCTGGGCGCATCAGCTGTTTTTATCGGCCGACCTGTCATCTGGGGGCTAGCCCACAGT
GGCGAG
CATGGAGTGACGGATGTCATCAACCTACTCAACGAAGAGCTCGTCCAAGCGATGCGGCTCATGGGCTGCAAAAAGCTTGGTGACATCGAGCGAAGCATGGTCGCACACCAAAGCTCCTAC
CACGCTAAGCTCTAG

Retrieve as FASTA