Entry information : EsilMSD02(Esi_0002_0116)
Entry ID 16943
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2021-01-30 (Christophe Dunand)
Peroxidase information: EsilMSD02(Esi_0002_0116)
Name EsilMSD02(Esi_0002_0116)
Class Mn SOD    [Orthogroup: MSD001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EsilMSD02
start..stop
S start..stop
KflMSD01 272 1e-93 9..230 4..226
MpMSD01 272 3e-93 4..224 15..232
MpalMSD01 269 4e-92 32..224 34..225
AtMSD01 262 2e-89 6..223 3..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 618099..618112 14 N° 2 617736..617904 169 N° 3 616236..616376 141 N° 4 615648..615848 201
N° 5 614664..614831 168  
complement(join(614664..614831,615648..615848,616236..616376,617736..617904,6180 99..618112))


exon

Literature and cross-references EsilMSD02(Esi_0002_0116)
Protein ref. GenBank:   CBJ48355.1
DNA ref. GenBank:   FN648375.1 (618112..614664)
Protein sequence: EsilMSD02(Esi_0002_0116)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230
PWM (Da):   %s   24814.52  
PI (pH):   %s   7.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMFSRVACNAARRVPSAGRMISSSAAARAPAVLPDLTYDYGELEPAISGEIMKIHHTKHHAYINNLNAAMEKLADAEAKGDVTAILQLQAAIKFNGGGHLNHSIFWKNLAPVGKGGGEMVTGTLADMIEAQYHSMGELTEKMSAASVGVQGSGWGWLGYDKVNKRLAIATCANQDPLEATTGLVPLLGIDVWEHAYYLQYKNVRPDYVKSIFKVVNWADVQERLTAATS*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTTTCGAGGTAAGAGTGTTGCATACCCTACACCACGGTATTCGCATCCCGATAGCGCCAGTTTACCTCCAGGAAAGTTCGTGGCGGGTGAGTTTTGGCTCTACAAAAATATGCA
TGGGCTCCACGTTCCTTTCCGCACTTGACATCTTGCTTCTTGCCCCGCCTCCCCCCGCCGTTGTTGTGCAACTTGCTTTGGTGAGCAGGGTTGCATGCAATGCTGCACGTCGCGTCCCTT
CGGCGGGGCGCATGATCTCTTCGTCGGCTGCGGCAAGGGCGCCAGCGGTGTTGCCCGACCTGACGTACGACTACGGCGAGCTTGAGCCCGCTATCAGCGGCGAAATAATGAAAATTCACC
ACACCAAGCACCACCAG
GTCGGTTCGATCTGTTCGGTTGCCGTACACTTGCCTTACACGGAAGCGTCCATGGGTGACGCAAGAGTGTTGATGTTCTCGATCTGGAAAGTTGTTTGTGGCT
ATGCCTTTTTATGCACAGCCAGAGGAGAGAGAGCGAAGCATTCGGTGTGGACACTTACTGGTGGTTGGTGATCGGATGTTGTGTTGTTGACTCACATCGGGCGCCGTGTGCGGGGTGTAA
GGCATCAACCACACCAGCTCTACCTTCATAACAGCCCGCTTCGTGCGACAACATGACACAACATGACACAACATGACAACATGACAACATGACACAACATGACAACATGACAACACGACA
CAACATGACAACATGACACAACATGACAACATGACAACATGACACAACATGACAACATGACAACATGACGTGCGGTCACCCAGGATGGTCGCCGCCAAGCGGGCACGGCACGTGGGACAC
CCTTCCCTTCGAAAGGAGACGCATCACAACTTTTTCAAAGGAGATAACCACGTCGTTGACTCTAGGGCGGCTCATTTCTATTTCTTCCCCAGGCGCTACTGCTGTTCCACGAATGGTGTA
CATACCGGTAAATCCCATAAGAGGATGAAAACCCCCAGGGGATGAAAACCCCGCCCGACCAACCACCAACACTAGAGAAAAGCACAAATTGAGGGGGATATTGTTGTATCGTTGCCTTTT
CAAAGTAGGGGAAGAGGAGATACTGGATGAAGTTTACGGTTGTTTTTTCATGCGAACGGAGACATGAACGGCAATAGCAGCATTCAACAACACCATCACCACCAACAACAACACGAACAC
GGTGGAATATATGACTGTTGTTGTGGAAGAGCCCCGCACTTGGATGTTGAGAACCTCGACGGGAAGCACTGGTGGTGTTTGTTGCTTGACGACCAGTCCGCCAAGCGCAGTACAAAAATG
CTACCCTTTTGCCAGTGGGTGTATGTCCTTGAGAACAGCGTGTGTTAAACGCAATATTACCAAGTTATGCCTCGCAGGACAGCAGTACTTTACGTGCTGCTCCTGTCGTGGCGCGACTAT
TCATTGCGAGACGAAAATAAACGCCATCGACGCTTAGGACTGCTACTCTGTGCGGCCCGCTTCGTTGCCCATTCTGCTGCTCTCCGTACCCGCGGTCATCAAGTTTTGATCCGTGCAGCA
GTGACGCTAACACTACTCCCATATGATTCCACAACGAGTAATGGTGGTGATGCTTCTGGATTGTGGAGTACCGCGCTGGAAGGCTCAGCGCTACAGGTCGTGGATTTTGGGACTGCTTTG
TCACCCCGCGTACCTTTTTTCGGCTGGAATTGGAACTGCTCCTTTGAAATTGTCAGGCGTATATCAACAACCTGAACGCGGCGATGGAGAAGCTGGCAGATGCGGAGGCGAAGGGAGACG
TGACCGCTATCCTTCAGTTGCAGGCCGCCATCAAGTTCAACGGCGGCGGCCACCTCAACCACTCCATCTTCTGGAAG
GCAAGGGGGAGAGCGAGAGGCGGGGAGAGAGAGTTCAAGAGTT
TACCACCTTTGATAGCTGTGATCGTGGAGCTGGCTGCCCTGTCACCGGAGTTTCCCAATACCTTGGGCCACCTTAGGTTGTTTGTCCCAATGAGTGCGCGGTTGTTTGGCAGCGTGGCGC
TCAAGAAGATACGGAACATGAGGGAGGGGCCGTATTGTCTCGGTTGCGTTTTTTTCTTCTTTCGTGTTTTGTGTTTTGTGTTAAATGGCCGCTAGACGTGACCATGCTCCAGAGGACCTC
GTGCTAGTATGTTTAGGAGCACAGAGACCCCAGAACATGTCGATACGCTTTCGAGACTTGACCGCTAGGTCCTCTAAGACTCGCACTCCGCCCTTCCCTCGCAGAACTTGGCGCCCGTGG
GCAAGGGGGGGGGGGAGATGGTAACCGGCACCCTGGCGGACATGATCGAGGCGCAGTACCACTCGATGGGAGAGCTCACTGAGAAGATGAGCGCGGCGTCGGTGGGCGTCCAGGGGTCCG
GGTGGGGGTGGCTTGGCTACGACAAGGTCAACAAACGGTTAGCAATCGCCACCTGCGCCAACCAG
GTTTGTGTGTGTTGTATGAGCTGGACACATTTGCTGCGGGTAGGTTGTAGACAAG
TCCCCCCGAGAAGCCATGAGTCGCTTGATGCCGTGTATGAACCAGAAACGCAAGGAGAGGCCCAGCAACTCTTTCACCGGTTCAAGCGATACAAAGTTCATGTGAAGGCCGACCCCAACG
TGGCACTTCGCGAGTGGGAACAAACAACTTTACGGCATCAAGCGACTCCATGGCTTCTCGGGGGGACGGGTGTTGTTTCTCTTTGGGTCCGCCGCGTGATGTAGATTAAAGGGGTGCCAT
TTGTGTTTTTCTCGTGGTGTTGTGAAAGGGATGGGGTTGGCGGGTTCTGTCGACGTTTGGGCTCTGTGGCGTGTACCCCGTGATCTATTGGTTCCATTTTGTTTTTTGTTGTGTGCTGGG
GTTGTCTTGCAGTCAGCTACGCCCCCGAACTGTTGGTTGTGTGGATATGCCAATCGTATTCAACCGTTTCTACTACTACTGTACTTCCACAGCAGTGTGCCGAGAAGTTTGCCCCTCGGA
CATTTTTTCGTGGACGCAAGCGAGTGCGGTACCGAACCAACGTCGTTCGTTGCTCTTCCGTCGGTTCGAATTCGACCCCACTAGTTAGGCCTGATCCTTCATTCTGTTAGCTTTTGTTGC
CCAGCCATGAAACACATTTGTTGCGCTGTTGGGTGTGTAAAAGTGTAAAAAGGACAGGATCTCGAGCGAGTCGAGCACGCGCAACAGCAGCGCGAAAACGAGGACCTGACACCCTCTCAC
CCTCGATGTCATCTCCACCCCGGTCATGTTTGATTGTACAGGACCCGCTGGAGGCTACAACCGGCCTCGTGCCCTTGCTAGGGATCGACGTGTGGGAGCACGCGTACTACCTCCAGTACA
AGAACGTCAGGCCCGACTACGTCAAGAGCATCTTCAAGGTGGTCAACTGGGCGGACGTTCAGGAGAGGCTAACCGCGGCGACATCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTTTCGAGGGTTGCATGCAATGCTGCACGTCGCGTCCCTTCGGCGGGGCGCATGATCTCTTCGTCGGCTGCGGCAAGGGCGCCAGCGGTGTTGCCCGACCTGACGTACGACTAC
GGCGAGCTTGAGCCCGCTATCAGCGGCGAAATAATGAAAATTCACCACACCAAGCACCACCAG
GCGTATATCAACAACCTGAACGCGGCGATGGAGAAGCTGGCAGATGCGGAGGCGAAG
GGAGACGTGACCGCTATCCTTCAGTTGCAGGCCGCCATCAAGTTCAACGGCGGCGGCCACCTCAACCACTCCATCTTCTGGAAG
AACTTGGCGCCCGTGGGCAAGGGGGGGGGGGAGATG
GTAACCGGCACCCTGGCGGACATGATCGAGGCGCAGTACCACTCGATGGGAGAGCTCACTGAGAAGATGAGCGCGGCGTCGGTGGGCGTCCAGGGGTCCGGGTGGGGGTGGCTTGGCTAC
GACAAGGTCAACAAACGGTTAGCAATCGCCACCTGCGCCAACCAG
GACCCGCTGGAGGCTACAACCGGCCTCGTGCCCTTGCTAGGGATCGACGTGTGGGAGCACGCGTACTACCTCCAG
TACAAGAACGTCAGGCCCGACTACGTCAAGAGCATCTTCAAGGTGGTCAACTGGGCGGACGTTCAGGAGAGGCTAACCGCGGCGACATCCTAA

Retrieve as FASTA