Entry information : EsilMSD01 (Esi_0091_0024)
Entry ID 16944
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilMSD01 (Esi_0091_0024)
Name (synonym) EsilMSD01 (Esi_0091_0024)
Class Mn SOD    [Orthogroup: MSD002]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilMSD01
start..stop
S start..stop
CbraMSD01 242 4.82e-79 91..299 92..322
CbraMSD02 228 5.89e-75 91..298 3..231
CbraMSD03 185 3.62e-57 95..288 107..302
PpaMSD01 179 1.19e-55 95..287 36..225
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16944' 'join(107575..107659,109146..109264,109890..110030,110709..110756,111060..111141,111566..111636,112514..112664,113368..113513,114297..114356)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 107575..107659 83 N° 2 109146..109264 117 N° 3 109890..110030 139 N° 4 110709..110756 46
N° 5 111060..111141 80 N° 6 111566..111636 69 N° 7 112514..112664 149 N° 8 113368..113513 144
N° 9 114297..114356 58  
join(107575..107659,109146..109264,109890..110030,110709..110756,111060..111141, 111566..111636,112514..112664,113368..113513,114297..114356)


exon

Literature and cross-references EsilMSD01 (Esi_0091_0024)
Protein ref. GenBank:   CBJ28064.1
DNA ref. GenBank:   FN649149.1 (107575..114356)
Protein sequence: EsilMSD01 (Esi_0091_0024)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   300 (295)
PWM (Da):   %s   31713.34 (31757.6)  
PI (pH):   %s   6.85 (5.36) Peptide Signal:   %s   cut: 27 range:27-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLHSTLSYCSYQVHVTMKFTTSLVLSGAACASAFVGTPVSTRASLKSSAVRMSVSDSMGSLSRGDALAAAASAAAAGFVFSNSFPAFADGPYNLPDLPYSYDALEPYIDAATMKFHHDKHHAAYVGNANKALAGKTAPSLLDLQKDAI
KTGVRNAGG
GHYNHCLFWNTLCNHESSGAPSGLAKAIDEAFGSMDEMKAQFGTTAAGVFGSGWAWLGCTPDGKLAITGTPNQDNPLMEGAAGTAMVPILGLDVWEHAYYLKYQNRRPEYI
SAFWNVVNWA
VSENYEMYASQGKGVPVQG*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCATTCCACGCTTTCCTACTGCAGCTACCAAGTGCACGTCACCATGAAGTTCACCACGTCTCTCGTCCTCAGCGGTGCAGAGGTGGGTGCACACATTTTCCCGCAATCCTCGGTG
CAAGCGACAACGGGTTGCCAAAGAGCGTTCATCCAAAACTCTCATCCCGCCTCTTTGTCTCGCGCCCTCTGATTATCTGATTTGGGATTGGGTGTGTGCATGATGCAACGCCCGGTCGCG
TCTATACCTCTTCCCCGTGGGAAAACTACAAGGGCCTTACCCATGGAGAGTGCTCTGCCACGTTGCGGTGGTTGGAGTGATTGCGTTGCTGATTTCTTTGCAGTTTTCTGGATGCTCACA
AAGGTGCTCATGTGAAGCACGTGTTCTCGTTGCATGGCCTTTTTTGGCCCGCTCCTTTCGCGCATTGGCGCGGGATCCATCGCAACGCGCCGGGGGGATGTGAGGTAATCTAGTATGTTG
CCGTTGCGGATCGCGGCAGCGTGTCTCACGCTTTGTCCCGAGGGCAGAGAAATTGCATGTGTCCATGGTTGTATCCTCCGATCGAATTGCGTTGAACCCGGAATCATGAAATCAAACGAA
AGACAGGCGGGAAGATATTGTGCGCTCGATTTACTCACCTACATACTACATGTAACCTAGCTTTTCATGTGCAAACCTCCTTGTACCCAAATGTACCTTGGCGAAAAATATACCAGCAGG
ATTTAGCGGGAGGTGTGAAGTCAGTCAACGTGTTTCTACGTTTCTACAACTTCTGTGCATCCAATTGTGTTGTGCGAAAATTGTCCAGCTTTCAGCAGATAATTGTCATCCTGTGATTGC
CAACATGATCGCGGGAGACAGCAGCCAGTTGTTGCTGTTGGATTGCGAGCGCTTAACTCTTGCGCAGCACCAGACAAACCTCAACGATTAGATACGAGCGTTTTCGCCTGATTCTGCCCT
GAATCGGCCACCCGCCTGTTCCAAACAAGCCCTGCTATACGTCGGGTCCTGCGCTTCTTTGGCATGAAGTACACAGACATGTGCACGCGACACTGACCACGTTTATGTGTGTATACGAAT
GAACAGCTTTTGCTGTTTGCATGTTTTCATCAACAGAAATGTAAACAAGCCAACACAGCAGCGTCCCTCCTTGAACAGCAGTAGTATCCTGTCTTTGTGATAATACATCATTGCAGAGGA
GGAAACTGGGTGGAATATATCTACCCAAGCTGACCGCCAGCATGTCAAACATGGACAGGGATCACCCCGGTTCTCAATCACGCCGGATCCATTATTGCCCCGTTTTTTGTTTGGAGCAGC
GGCACTGCTGTGTCGCGCTCCCGCGGTTCGGCCGTTGCCTGTCAATCCCCCACGGCAAACTCCCCACTACTTCGCGCTGATTTTGTTTTGGGCGAAGGCAAGAAATACACTCTGGCCTGA
GTCCAACACACACCCTTCCCGGCGTGGCGTCGCTCTACTCTTTCACTGTCTCTCTGTTGTGGTCGTGCTTGGGGTTGTACTAAATAATGTAATCCTCACCTCCGTGCTAATACAAAATTG
TTGATGTCTCCAGCATGCGCGTCGGCCTTTGTGGGTACGCCGGTGTCCACGCGGGCATCGCTCAAGTCGTCCGCGGTGAGGATGAGCGTGTCCGACTCTATGGGCTCCCTGAGCAGGGGC
GACGCCCTCAAG
AGGTGAGTTTAGGACATGTCGTAGGTTGTGCTGTTGGGTTTATTTTTGGCGTCACTGGTTTTGCGGGTTGTTCCGACAAAAGGTGACAAACATGCCTAGTCGTAGAAT
GCGCATGACCGCGTGTAGTGATACAGACACATGGAATGACTTTTTGGGGTGGATCAAACTTTTTTTTTCCACGCACCTACACACACCCAGCCCAGTAATTTAAGGCGGCACCGCACGTTC
TCGTATGGGGGACGCAGAGAACCTCCTAAACAAAGCGTCGTTCTGAAGTATGTGTATCCCACCGCTATACCGTACGAGTCGGAGAGATGGCACCCCCCTGGTAGCGTTTTTTTGTAGCGT
ATTTCACCACAACCAGGGGGTACCAGTGCCGAAAAGGGTAGTTTTGGACACATCTCGTCGAGGGCTTTCCTGAGAGGTATCGGTCGGTGTTCGCACCCTCCTACTTGTGGAGAAATAGGC
TAAACGAAAACGCTAACACGGGGGTGCCATCTCTCCGACTCTTACGGTATTCGTTTCTCACGTGTTGTCACGCAATGAAAAACAGTTCTCCCCCGCCATACAATCGTGCAAAGTACCTCG
TGCTATTTTCTGTCGCTTTTTTTTTTCTGTTGACAACAGGCTGCTGCTGCATCCGCGGCCGCCGCGGGCTTCGTGTTCTCGAACTCTTTCCCCGCCTTCGCCGATGGGCCGTACAATCTC
CCCGACCTCCCGTACTCCTACGATGCCCTTGAGCCGTACATCGACGCCGCCACGATGAAG
AGGTGACAGAATCGTCAGGATCTCAGTGAAGTTCAATCAGCGGTTGTTTTTTTCTTGTCG
AGAGTTGGGGCACAGTTTTGGTTCTTCAGCAACGGGGTTTCCGCGAGGCTGCAGGGAAGCCAGGCGGGGGAAGGGCGACCCGGTAATTTTTCTATTTTTTCTATCCCCTACAGACAGCGA
CATGGGACATGCCTCGACTTCGGAGGGTGGCTCACACCCTGCCTGTTGAACGGAGCAACCCGTGCACTTACTGTTCAGAAGATGCAGTGTCGAAGATATGCGCGTATTTCCTAGGGTGTG
TATACAAGTAGACCGCCTCTATGCCCGCAGGTACATCTAGTGCCCAACACGCATTTATGGCCAGCGGCATATTTTGACGAGGTCGAGTGTCAAGGTGGAACATGTCGGAATTTTTCGGCC
TCGCATGCTCTTCTTGTGTTATCTTACGGCCGTTCCCTCTTGTTGCACCGGGTGTTGTCCGCGTGATCCTGCCGTCTCGGCGTGTGCCCTATCTTGCCGTTGTTTTTCTATCAACATGAC
ACACTGCCATTGTACTATGCCCTTTCCGGTGCTGGCGATGCATCTCTGCGTCTGCTACTGGATGTTTGGGCTGGGGGGCATTGACGCCTTTACAAACCAACACCCGGGTGCGGTTTGCCT
GTCTTGCTTCCTCGCGGCAGTTCCACCACGACAAGCACCACGCGGCGTACGTGGGCAACGCCAACAAGAGGTGAATCTGATTGGCCGGCAAGAACGGCATTCGGCCATGGGGAATAATTC
CTTCGTCGTCGTACAGTACCGGTCTAGACGCTATCCGGTGTTTGCAGCGCTTACTTTTCTCTGGCGTGTTGTGTCTGTAGGGCATGGGGATTGCCAGCAGGCCCCTTTCCCGTATCACCT
GCAGTCCAAAATTTCTCGCTCTTTGGTTACCTGTAGTCTTGATAATGCCTATTCGTTGACGCTCGGTGTTCATCTGTGTGATCATTTCGACCGACGTGATTCCATGTGATGTTGCGTGCT
GCGGCTGGAGCAGGCCCTCGCCGGCAAGACCGCCCCTTCGCTGCTCGACCTCCAGAAGGATGCCATCAAGACCGGTGTCCGCAACGCCGGCGGCGCGGTGAGAACAACTCACTTGAACTT
TGCTGACTTCTTGTATCTAACTCGTCGCGAACTTTAAGTTGCAGTTTATTTTCTTTTTTTTCTGCGTCTTCACGTGATAACAGCTCGCTCCGTTGCCTACGTTTCACGGCAGGCCTCATC
GTTTGGTCTCTCACTTGGGCGGCTTTTGTCGACTGGTTTTCTCGATGTGACAGCCGCAATTTATTTTTAACATTTACAGGTGCCTTGATCCGTACTTCGACCCCGCTCCATGCTATGACG
CTCTCAGGAGTATCTCCCAATCACCCCATGAATTTTCTTCAGCGCACGGTTTATTTTATTTTCCTGCTGCTCAACTTTGCCGCGCTTGGTCCCCGTCCCTCCTTTGCTGACCGGCTCCCA
CGTGTGTTTTTGTTTTGTGTTTGCTGCGGGTGTTATTTCAGGCCACTACAACCACTGCCTGTTCTGGAACACCCTGTGCAACCACGAGAGCAGCGGCGCTCCCTCCGGCACGCGGTACTT
GTTGTGTCTTTACTGCGATACAGGATTGCTATATACCCGTTAGTGCTTGTTTCAACAACAACCGTTCTGACGTGTTTCGCTCTGATCGACCGGTACAAACAACGACGAGTCAACCAAGAA
AGTCCTGCCGTAGATATTTACAAAAATGCACGCACAGTGTGTGTGTTCATTGGATCTTCTGATGGCTCTAGCATTTTTGTGACCACGGACCGAGTCTTCGCTAGATTTTGGGAATAGCAT
CTGACACGAGTTTAATGTGAAAATAACAACCACAGCTACGCATTGACGAAAACGTGGATGCAGGACACGCACCCCGCACGAGGATAAAGCCCTCCGTTGTAACTTTCATTTTCACTCGCA
ACTTCAATCAAATATGAAACAAACGAAGTTACCGCATAGTTCGTTCTTTCATCACAACATGCCAGGGTTTTGTGATGTGTTTCATCACCGCCGTCGATGAGGATCAAGATTCCTCCTATG
AATAGTTCAGAGTGCCGTATCCCGTATGCCAGAGATGACATCTTCCATTCTAGCCTTTTCCGTGATCTGGATGCCCTCGGTGGCGTAAGAGGACACGACAGAAACTGCCATGGGACGTCC
GTCGTATTTGGGATATTTAAGCAGGGGTTGGTGTTTCTTCGACACTCCATGGTGTCAACCCAAGCAGCACTTGCACTCCATCCACCTTGCGCTCTAACGAACGCACGAGAATTTCTGCTT
CCTTACAATGTGTTTTGTAGTCCGCCTGCGTTCCCGTCTGGTATCCTTTTCATTTCCTCCGTTTCGCTCTGTACCTTTTGCACTCGTTTCTCTCTCGCCGTGTACTGGCGACATCCTCTT
AATCTCGGCCCGTGGACATCGAAACCAAAAGCTGGCGAAGGCGATCGACGAGGCATTCGGGTCAATGGACGAGATGAAGGCTCAGTTCGGCACCACCGCGGCAGGCGTGTTCGGCTCTGG
ATGGGCCTGGCTCGGTTGCACCCCCGACGGAAAGCTTGCCATCACTGGCACCCCCAACCAAG
AGGTCAGGCAGCGAGTGAGGAGTATCAACACATGATTGTGTTGTTGTGTGTGGAGCTT
GTTTAGTTTGTATCGACGGCGCGAACCGGCTGATCTATGAGTGTGTCACCTAACAAATCCACAACCAACATGTCCGATTTCATGACCCCTTACAAAAGATGATATAGCGGAGCTCGTGAG
CTCAGGGCGTTGTTGCAATTTTCTTTGGTAAATGCGATGGCTCGAGTTTCTGTCCCCTCCCCCTTGGTGTCGCATAACGGCTGGAACGTCGCTCGAAATATTGTACCGATTTTGCCGGTA
TCGAGCCAAGGATGATTGTTTTTGTCACGTACGAGGTGTGCGTCCATGAAGCCGTCTGTAGTCGTCGGTCTCGGCATGCATACTGACGGCACACTTTCGGCAGAAGTCCGCGGACCCAAT
GCTGGCAGTTTCACGACCCATGTGATGAGACTTGTTTCTCCTCGAATACCCCAGCGATGATTTCTCAGCGGCAATCTCTTCGAGCATGTTGCAGGCACCAGAATACCGTAAGCTCAAGAT
CGGTCATGGTCCGGTGTTGGCGCCCCATATGTAGCTCGCGCGTTGCTATGGACGCGTAGGAGATGCTTGCCTTTTTACCGGAGAGCGTTTGCTCACACTTTTAATTTTCCTGCTGACCCT
ACTTTTTGTTGAAGTCCCCCCCCCTTTCTTCCTCGCGTGAACGCTAGACAACCCCCTTATGGAAGGCGCAGCCGGCACGGCGATGGTGCCTATCCTCGGCCTCGACGTGTGGGAGCACGC
CTACTACCTCAAGTACCAGAACCGCAGGCCTGAGTACATCAGCGCTTTCTGGAACGTAGTCAACTGGGCGGTG
TGGTAAGTTGATGGAACATAAACATTTGTAACGGAGCAGCACTTCGC
TGTTTAGCGATCGCAGGTGTATTTGTACAGCTTCCTTGGAGTGCTCGTGTGCCCGTGCTACATCAAGCACGTCCATGATACTTCAGTGATACCAACGCGTAATCTTGGGTACATGCGGCG
CTCCCTGTGACGTCAACTGGGCGGTTGCGTTTCCATTTTGGACGGCGGTTGCATTTCTGGTTACTACATTTCCGGTGCTCCGGTTCCCGGAACGACCCTTCCGTGTGGCGTCCGTGAAAC
GATAGAAAATACGAACTTAGCCTGATGCTCGTGTCGCTCTACCAAGAAACCCCCCTCACATGGCTTGGCACTGAGGTTGATGGGGTGCTACTGGCGGATTGCCATGATCCAGTGTGATCG
ATCGCACGATGTGATTTTGCCTCTGGTCGTAGTGTCGATGGGCTGGAATCAATCGTACAGCTGGCTTGGAATTGTGTGTAGAGTCGTGTTGTGGATTCAATTATTTTTCCGACTCAACTT
TCTTTGCTGCGAAGAACGTATTGTCGCCACAGGATGACCCCGATAGTGTCTCATCCAAAACATTCCAAAAATGGGTTACGATCCAACGCCTGCCGTGCGACTCTAGGCAGGCGTTGCAGT
AACTCTTTCTTAGCCGGACGCGTCATGTCTTTTGGCGCCCCGCCTCCATGTCTTTGCCAACTCTGTATCTTACTGAATCTCGCCTCGTCCGCCCCATATCTCCTCGATCTTTTCTGGTAT
CATGCAACAAATTATCAGGTGTCTGAGAACTACGAGATGTACGCATCCCAGGGCAAGGGTGTGCCGGTGCAGGGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCATTCCACGCTTTCCTACTGCAGCTACCAAGTGCACGTCACCATGAAGTTCACCACGTCTCTCGTCCTCAGCGGTGCAGCATGCGCGTCGGCCTTTGTGGGTACGCCGGTGTCC
ACGCGGGCATCGCTCAAGTCGTCCGCGGTGAGGATGAGCGTGTCCGACTCTATGGGCTCCCTGAGCAGGGGCGACGCCCTCAAG
GCTGCTGCTGCATCCGCGGCCGCCGCGGGCTTCGTG
TTCTCGAACTCTTTCCCCGCCTTCGCCGATGGGCCGTACAATCTCCCCGACCTCCCGTACTCCTACGATGCCCTTGAGCCGTACATCGACGCCGCCACGATGAAG
TTCCACCACGACAAG
CACCACGCGGCGTACGTGGGCAACGCCAACAAG
GCCCTCGCCGGCAAGACCGCCCCTTCGCTGCTCGACCTCCAGAAGGATGCCATCAAGACCGGTGTCCGCAACGCCGGCGGCGGCCAC
TACAACCACTGCCTGTTCTGGAACACCCTGTGCAACCACGAGAGCAGCGGCGCTCCCTCCGGCACG
CTGGCGAAGGCGATCGACGAGGCATTCGGGTCAATGGACGAGATGAAGGCTCAG
TTCGGCACCACCGCGGCAGGCGTGTTCGGCTCTGGATGGGCCTGGCTCGGTTGCACCCCCGACGGAAAGCTTGCCATCACTGGCACCCCCAACCAAG
ACAACCCCCTTATGGAAGGCGCA
GCCGGCACGGCGATGGTGCCTATCCTCGGCCTCGACGTGTGGGAGCACGCCTACTACCTCAAGTACCAGAACCGCAGGCCTGAGTACATCAGCGCTTTCTGGAACGTAGTCAACTGGGCG
GTG
GTGTCTGAGAACTACGAGATGTACGCATCCCAGGGCAAGGGTGTGCCGGTGCAGGGTTAA

Retrieve as FASTA