Entry information : EsilFSD02 (Esi_0201_0013)
Entry ID 16945
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilFSD02 (Esi_0201_0013)
Name (synonym) EsilFSD02 (Esi_0201_0013)
Class FeSOD    [Orthogroup: FSD001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilFSD02
start..stop
S start..stop
EsilFSD01 237 3e-80 2..195 27..220
LeFSD03 184 6e-59 9..187 55..238
PpaFSD01 181 3e-57 5..196 71..266
CbraFSD01 174 1e-54 5..193 68..284
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 80090..80155 66 N° 2 78061..78097 37 N° 3 77358..77467 110 N° 4 76220..76414 195
N° 5 75584..75652 69 N° 6 75212..75266 55 N° 7 74695..74753 59  
complement(join(74695..74753,75212..75266,75584..75652,76220..76414,77358..77467 ,78061..78097,80090..80155))


exon

Literature and cross-references EsilFSD02 (Esi_0201_0013)
Protein ref. GenBank:   CBN79353.1
DNA ref. GenBank:   FN648378.1 (80155..74695)
Protein sequence: EsilFSD02 (Esi_0201_0013)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   21354.47  
PI (pH):   %s   5.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSIVLPELPWAKDALAPHISAETIEYHYGKHHAAYVTKLNAAISTNSELEGKSLDEIMKTASGGVFNNAAVWNHTFYWKSLSPSGGGEPTGAVKEAIEEKFGSFEAFKKAFSDTAAGHFGSGWAWLVKTESGGVDVVGTHDASNPVKEGKGTPILTCDVWEHAYYIDYRNSRPGYIAAWWNLVNWDFANENLAKC

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGATCGTACTGCCGGAATTGCCGTGGGCGAAGGACGCCCTCGCTCCCCACATCAGCGCCGAGGTGAGCTAGCTTCACGGTGGTGGCACCGCCGCAGAGGTGGCGTTCTTCGCTATG
GTTGTGCCGAAAGAACTTCCAAACCAGAAAATAGAGCCATCTGTCTTGATGTTCTCGGAGGGCGCGAAGCACCATAATAGGCAAAGAACCGCCTGGCCAATCTGAGTCTAGCATACATAT
ACAAAGTGTTCCTGCCACATTTTCTTTTGAAGAGAAGAGAATCGACAATATGCACCCAATCATGCCACAAGTATATTCACCCACCGCCAACGGCGGTGCTTACCGCTCTCATCGGAACTG
GGGTTAGGTATTCTTGCCCTCCGGTGTTGGAGCGCGATGCCGCGTTGCCCTGGTTTGTTCTGGAACACCCCGCAGACAGCAGCGGGAGGTTTCTTGGTAGTTTGTCCCGTTTTGTAGAAA
ATAAGCAGAATAAGCAGCATGCAGCAGTAGCTCACAGAAAGACTACCCGTTCGAGGTACAGTACAGCCACAACCGTGTTGACAGCAATCGAAAGGGACGTGTTGAAGTCTTTTCGGTGAG
TGGAGGGAAAACTCTGCTTGACACCGGCCTTATTTTTGCTTTTTCCCTGCTGTGTGTTCGAGTTTGTGTGCCGTACGGCAGTCGTATGCATGTAGTCTAAATAGGTTTTGTATGTATACG
ACTGCCGTATGTAATGCCGCAGACCGATTCACCCGCCCTGCACAGGACCCGCCCTATTCAATGCACTACATACCAACCGTCTTAAATATTTTCCATGAATATTCCATCTGTGCCAGCCAA
TTTCACCCGCACTATAGTGGGTGCCCGCCTTAAAGAGGGCCTACGACTTTGGCGCAATTTGTCACAGCAAATAACGCGCCCCGCATCTTGTACAGCAGTAGGCCAAGCTCACGCTTGATA
TATACAGCAGTTGCCCAGTTGCCCCCAAATGTCGGATTTATGATTTGTTTACAAGTAGGGGGGGGCGTTTTGGTGTTAAATCCGGGAAATCGAATGCCCGACCTCACCGCAACCGGGTTG
CATCTCCTGCGTTTGGCCTGGGTCATTCCGTCGATCCCGCCTCTCTACTTCTACAATTATTATTCCAACGGGTCCCACACCAATCAGGGTGGGATAACTGCCTCCGCCTGAGGTTTGCAC
CAGTTTTCGGCCACAACTTTTTCGCGGACAAACGGGTTTCTCTCTGCTGTAGGCTTGCGTGCATTTCGTGCGCTCTCGATCACGCCGCAATCCGTGTTACACTGACACGACGGAAGAAAG
TCCAGCGACACGATAGGGGATGGTAAGGTATCGTCAATGACCCTTCCTTCTCGAGGTTGCAGACGCGTTTCTGAAAATAGAAACGAGTTGGCGTCTTTGAATGGTCAACTGCTGCTGCAT
GACCAGACCAAGGTCTCCACGACAGCAGCAGCAGTGAGAGGGAGAGTAAGAGCCGTGTGGGGATACGGCGAGAGGCGGCGTAACATCCCCCGTCCACAAAGTCGTTTCAATCCGAGGGGG
AACGTAAATTGTCCCGGGCGTCCTACGCCGCTGCGTGTGATCACCGAGGCCTTCAACCGTGAAAAGTGGTTGGGGAGTCGTCCGTTTCTACCAGCTCTTACTAAACGTTTTTTCATGCAC
ATCTGGGTGTCCGCAGTCCGTAGCTCCCCGAATCGGGGGGGGTCTGCGGCCGTTTCTTTTTTTCCCGCCCCGCACATGGAGCGTATCGCTCCACTCATATGCATACGACCGCGTCGAGTG
TTGGATCAGTACGGCAGTACGGACATACGAAGGTACTGGGTAGAGAGAGATCGGAACGGTTTTTAATGTGAAGACAACAACAACAACAACAACAACAGTACGTATGCCGTCGACTCCCCG
GACCCCTCTGACATATTTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTACCGTGGTCCGTGCTCTTACTCCTCACCCCCCCACCCACCCCACGCCGCCGGCCCTCATCTCTTGC
CTCTCCTGCCCTCCGCAGACCATCGAGTACCACTACGGCAAGCACCACGCCGCCTGTGAGTCCTGCTGTACGCGGCCTTGCGTGTCGCTTGATCGAGCGTGTGTCCCGTCCTGTTGTGTC
GTGTCGTGTCGTGTCGTGTCACCCTCGTTCTCTGCTGTGCTGTAGGGCGCATGGTCGCGTTGTCATTCGTCCTTCCATTTCCCTCTTCCCCCGTTGCCCGGCCCGGTGAGAACCCGGCGT
GGTCCGTCCCGGCTTTGTAGGGATGCGAGGTCAGTGGTCTAACGACTACGGCATGCACGACTATGAGTACCCCCCCCCACCCCCCCCCCCACCCCGGGTTCCCGACTCTGATGTGATGGT
AAGGCAACCGCTTCGCACTGATTTTGGTGTGTGCATGTGTATCTGAAAGTCAAACTCGTGAGCTCGAGGAATATTCTCCAGTTGGGCATGAAGCCACGCGAAGAAGCCTATCGTATCTGC
CGCTACCACGCTCGCGGGCAGCCCTTGTTCTTCACCTTCACCTTTGTTGTATCCCTTTTTTGTCCTCAATCGTGACGTCACGAAGCCTGCCACGACCGTCCCAGATCTGTCACCGCGTCA
TTTCAACCCTGATTTTTTCTTTTTTCCTCTTTTTTTTTTTTTTGTCAGACGTGACGAAGCTCAACGCGGCCATCTCCACCAACTCCGAGCTGGAGGGTAAAAGCCTGGACGAGATCATGA
AGACGGCCTCAGGCGGCGTCTTCAACAACGCCGCTCAG
GTTAAGAAGTCGTAGCTGACAGACAGATAGTTCACGCGCGCGCAAACGAGGAGAGCAGGATATATCGAAGTTTCTCCTGGCA
GGGGGAAGGGGTGGTACTATGTTATTTTGGTGGCATCTTGAACAACACCGCTCAGGTTGAGCAATTGACAGAGCGGACGCGGCTAACGAGAAAACCAACGGTCCTACCGGTTCTCGAAAC
ATCTCGAGTAACGGTTACAATATTAGTCTCTTTTTTTGCACATGAAGTGATGCGGACGGACGGGTTCTGAAGGGTCCTGAATACGGTATCTATGGCTCCCGTGGATGGTACCCATTTGCC
ACCACGGCCCGCTGGGTCTCTCTCTATTTTCTCTGTTGGCTGTTTGCTGTGTTTGAAGGAAGAATGGTCGTTAACAAATAATGTGAAGAACTGGCTTGTAAAACACTGCTGTCCACACAA
TGTAGAAAGCTGTCGTTCAGTTACAGCCGGACAGGGTTTGTGACTTTTTGGCATAACCTCGCAGCGGTCTGGATGCGAGATCAATGTCGAATGGCACTAAATACGCAAGTATCACCTCGC
GGTACCCCCCCCCCCCCCAAAAAAACGAGCGCCCGAATGTTGGCGGTGCCCCTACTTCCGTGCTCTCTCAAAAAGCAAAATACCTTGGTCATCAATGCTCGTCGAGCATTCGGATGGGGA
GACGGCAAATACACACAAATACCGGGGAAGGACCTGAAACTTAAGCGTTGAACAGCTTTGGTGGTACGCAAAGATTACGAGGTGGCCCTCCGCTTCCGCTTAAGGCACCCCGATCCCCCA
GTTCCCCTCTCTTTGAATTTTTCGGAAGGTGTGGAACCACAGCTTCCGCTGGACACTTGAAAATTCTACGAAAATAGTACGAGTTGTCCCTCCGCTTCAAGCACCCACCTCTCGTCTCCC
TCTCTTTTGGCAAAACGGAAGGTGTGGAACCACACCTTTTACTGGAAGTCCCTCAGCCCCAGCGGGGGCGGCGAGCCCACGGGCGCCGTCAAGGAGGCCATCGAGGAGAAGTTCGGGTCG
TTCGAGGCGTTCAAGAAGGCCTTCAGCGACACCGCCGCGGGGCACTTCGGCTCTGGGTGGGCCTGGCTCGTCAAGACGGAGTCGGGGGGAGTGGAT
GTACGTTTCTCTCGTGTGTTTTGT
TAATTGGCATCGACCGCGCTTACCGGCTGACGAATGAAAGGACATCAGTCCCAGTGCGGTTGAAAACGCAAAATGCGCCTGATGGCCATGATGTGGCATGTGTGTGTGTGATGTTGATTG
GCATCGGCGGCGCTAAACGGCTGACCAATGAAAAAGACCGGCAGGAAATGAAGGTCCCTGGATGGGGGGCCAAACGTCATGGATGGGTGCATATCGTGTTTTGCATGTGAATGTGTGTGG
GCGCGCGCGAGTGGAGACCATGATGTGCGGATGGACACATACGTGTGGAGGCCGTCATCGCACAGGCGTGAAAAGTATGTTGATCTACGCGTCGTCGATCTGGAGGAGTATGGAGAGGAA
GCGGCGGGACATGAAGGACGTTGTGGTGATACATGTTCTGCGTGTGGGTAATTTTGTGCTGCAGACGGCATGTTTTCCCGCCATTGAGTCAGTCTATCTCTGGCTTGTCTACGTGTAGCT
ATGCTGCTTGTTTACGATGCGTGTGTAAGCGTGTGTGTGTTTTTTTTTTTTTTTTTTTGCCAGGTGGTGGGAACCCACGACGCGTCCAACCCGGTGAAGGAGGGCAAGGGCACCCCCATC
CTGACATGCGAC
GTAAGTAACGCATCGTGGTGCTGCTGCTGCTGTTGATCGGTGTTGGTGCTTGTCGATGGCGTTCGTTGTGGTTGTCGAGCTGCGGTTGTTGCTGTTGCGCTTTAGCTG
ACTAGAAAAGTCCGGGCTTCGATGCGGTTCCGGTGTTGTGGAGTTTGAATCTTACGGAATTAGTGGCTCTGTTTTGTAGTAATGGATGTCATAGCTTGTTGATGGAGTCTTGAAACCAAC
TGCGTTGTGGGGCCCACCACCTGGCGGTTGTGATGCGAAAAAAACGTTTACTTTTCTCTCCGTCCTCCCGCTATTTCTATGGGTGATAGGTGTGGGAGCACGCGTACTACATCGACTACC
GGAACTCTAGGCCTGGGTACATCG
GTGAGACAAAACAAAATATTGATGGTTGCCCCCCGCCCCGCCCCCCCCCCCCATGAAGGACGATATGGCTGACATACCCATAAACAGCATGATAGG
GGAAAATGTACCCGAACATGGTTGGTTCAGCGCGCTACATGGGTGAGAGCGCAGATAAAGCGTGTGCGTGTGCATGCATGACTTCGTGTCGCGCCAAGCAGCGATATCACTCGGGTACTT
TTGAGGCACGTGAGCTCCCGTAGACCTCGCTAGCGAAATTCGAGTCAATCATAAGTGCCCGATTGCGAGGACGCTGGGGTCTCTTGGAGAGACAGAGGGTTGCTCGTGGTGATTAACAAG
AGTGTTGCCACCCTGCCAAACACAAAAGCAAATATTTGGAACAACTACCTCCTTCGCAAGACACGCACCCAAAGCCTCACCGCCCCCGCCCCCTATTCCCCCTCTCGACTTCCGACTGCC
AGCTGCATGGTGGAACCTTGTCAACTGGGACTTCGCCAACGAGAACTTGGCCAAGTGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGATCGTACTGCCGGAATTGCCGTGGGCGAAGGACGCCCTCGCTCCCCACATCAGCGCCGAGACCATCGAGTACCACTACGGCAAGCACCACGCCGCCTACGTGACGAAGCTCAAC
GCGGCCATCTCCACCAACTCCGAGCTGGAGGGTAAAAGCCTGGACGAGATCATGAAGACGGCCTCAGGCGGCGTCTTCAACAACGCCGCTCAG
GTGTGGAACCACACCTTTTACTGGAAG
TCCCTCAGCCCCAGCGGGGGCGGCGAGCCCACGGGCGCCGTCAAGGAGGCCATCGAGGAGAAGTTCGGGTCGTTCGAGGCGTTCAAGAAGGCCTTCAGCGACACCGCCGCGGGGCACTTC
GGCTCTGGGTGGGCCTGGCTCGTCAAGACGGAGTCGGGGGGAGTGGAT
GTGGTGGGAACCCACGACGCGTCCAACCCGGTGAAGGAGGGCAAGGGCACCCCCATCCTGACATGCGACGTG
TGGGAGCACGCGTACTACATCGACTACCGGAACTCTAGGCCTGGGTACATCG
CTGCATGGTGGAACCTTGTCAACTGGGACTTCGCCAACGAGAACTTGGCCAAGTGCTGA

Retrieve as FASTA