Entry information : EsilFSD01(Esi_0219_0002)
Entry ID 16946
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2021-01-30 (Christophe Dunand)
Peroxidase information: EsilFSD01(Esi_0219_0002)
Name EsilFSD01(Esi_0219_0002)
Class FeSOD    [Orthogroup: FSD001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EsilFSD01
start..stop
S start..stop
EsilFSD02 237 3e-80 27..220 2..195
PpaFSD01 166 4e-51 26..212 67..257
CbraFSD01 160 1e-48 26..226 64..292
AtFSD03 153 2e-46 30..220 52..248
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19169..19309 141 N° 2 21008..21044 37 N° 3 21414..21523 110 N° 4 22176..22370 195
N° 5 22857..22982 126 N° 6 23207..23287 81  
join(19169..19309,21008..21044,21414..21523,22176..22370,22857..22982,23207..232 87)


exon

Literature and cross-references EsilFSD01(Esi_0219_0002)
Protein ref. GenBank:   CBJ30867.1
DNA ref. GenBank:   FN648397.1 (19169..23287)
Protein sequence: EsilFSD01(Esi_0219_0002)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   25431.71  
PI (pH):   %s   3.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSISSSCFALWGGLLLIPFCPQGYGQVELPALPYGESDLEPYITEETVGFHYGAHHQGYVNNMNAFIEADPDLEGLSLSALMDQTEGTIFNNAAIYNHNLYWNSLSPSGGGVPEGDLYTAIQSAFGSYEEFQTTFTDLASGHFGSGWAWLMMHEDGSVDVVDSHDASNPESDGLGFPLLVCDVWEHAYYLDYQNLRASYIEGWWALVNWDYAESEYTRVLDEYNKKD*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTCCATCTCGAGCTCGTGCTTCGCCCTCTGGGGAGGACTGCTGTTGATCCCCTTCTGTCCGCAGGGCTATGGCCAAGTTGAGCTCCCCGCCTTGCCGTACGGGGAGTCTGACCTT
GAGCCGTATATCACCGAGGAG
GTGAGAAGGAATAACGACCGGCTGCGTTGATGATGGCAGAGAATATCTACATACCATCAAGTAGATAGACTACACTGAGGAGTCTGTACTGTAGTATCG
TTGAGTCTCTATCTGCTGCTGCTGGGCAGAGACTGCAGGGTCTTGGCTCTGTTGTTGTTGTTGTGCCGCTGATGTACAGCAGCAATTCTAGACCACATTAGACTATCCGTGCATTTTGAC
TTCATAAATACAGAGTTCATGCATGGCATGCATAATATTATGCATTGTCTAGTTGAATTTTTCGTGTAGTGCAGCCCCCGCCAAAAGAACACGAAAAAAATGGGATCCATCCGATGAGAA
GGAAGAGAGTGCTGCACGATGAGAAGGCATAGTACCGCAGGAGGGGTGGGTAGGGGTGAAACCTTCAGTGTGGCCACGGTTTGGAGTAAACGGCACAAGTGCGGTGAACGCTGATTTGAA
GCCAAGACCAAAAAAAAAAAAAACATGTGGGCACCTTGGGCACCACCAAGTGGGCTGGTCTGGGTTGGCGGCGGACGCGCAACAACAGCAGCACTGTTTTGTAACAGCGACACCAGTCCT
ATCTATGGTGGTGTGGTGCTGTACGCGGCCACCATTGTTGTTGTGTGTATGCATACAATGCATACATTTCTACAAAAGAGGCACGTTATTTAAACTACAGCTCTTCCTTGGTCACAGAGA
GAAGACAAGAGTGGATTCATGCGGATAATATTAGTGTACGACGTGGCAACCTTCGACCCGCGCGTCCTCCGGCTTGCGGTGGGGGTATACGATGATATTGCATTCTAGATGGGAAAGCCA
AACCGCACCGTTAGTGAAAAAATAACGTAACAGCAGGTGAGCGGCGGGCATGGCGGTTCCGGGGTGTCTGGGATTTGAATCACAGTTTTCGGCAAATAGCAGCACCAAAAGGAGGTGGTG
TCCTGTCCGCCTCAGTACAAACCCAAATCTCAGGAACTGCAAACCTTCCATTAGAGTTGGTCTGTAAAGTATTTTATTTTTATCTAAAACAGGACAGACGGCACGACTGCTGTACTGCTG
ATGTCGTTGTCGCGCTCTCGTCTACCTAGTTGCACGGCACGAGGAAGAGTCTCCACCGCACACCACACACAACGGGCTCCACAGCCACCCCGTGAGCGCAATATGCCCTCCTGTATGTAT
GCTGACCAACAGAACGCGACATGTAGCGGCAGCAGCTGCTGCCACCAGTACCGCAAGGATGGATATGAACCGCAGCATGTGCCGCCGCTCTTTGTGGGTTTGCCCCCCTCCCTCCGAGGT
TTGCCAGAAGGTGCTCCCAGTTTGTGCCAGAGGGTGTTCCCGGCTCACGCAGCTCACTGGCCTCAAGCCCCTTGTTCACATCTATCTCCACACACCGGAAAACAAGCGCGTTCTCAACCA
CAGCCTATTCAAAGTTTTGAAGCACACTCAACCCCAACTCGGGGTCTGTTTTTTTGAAAAAGCCACACTTTTGGTCCCCTAGTTCTGTGGATCTTCCTGTTCTAACTCAGGGTCGGAATG
TGAATCCGATTCAGACCCACCCTAAAGGGTGCCGAATAGACCGAACGAAGAATGCGTCGTCCTTCCGTACTGTACTAAAGATTCATCCGCAATGTCGCCAAACTCCCCGCCCCATTCCAT
GCTGTGTATGCTCCGTCCTTCCTTGCCCTTGTCCGCCAGACCGTGGGCTTTCACTACGGAGCGCATCACCAAGGATGTAAGTACGGCACTGATTTGAAAGCACTCGTGATTCGGTTTCGG
GTGGGTGTTGGATTGGGTGCACGCCCTAGAGTGTCTGTTTTCTCCTTTTTCCCCGCACCTGTCTGGAAGGAACGGCTGGTGGTGAGTCGTGTTCGGAGGTGCCTATTGCACGAAAAAATC
TGCCGCTTTGTTCCACTCCTCGAGTGTGAGGTGATCTTTGCGAATCACGTTGAGCGTAGTGGGGCGCAGGGAGCCTTGGGATTGAGATGGCCTCCTCTTGTCATATCCCTAGGTCATTGT
GTTAACTTTCCTTGTACAATCTTGATTTTTGCGCAGCTTATTCTTCCTCGTGCTGTTTTCGTGGCTTGGTTGTGCCGCCCCGCAGATGTGAACAACATGAACGCTTTCATCGAGGCTGAT
CCTGATCTCGAGGGCCTTTCCCTCTCGGCGCTCATGGACCAGACCGAGGGGACAATTTTCAACAACGCCGCCCAG
GTGTGGAAAGCATCACATATGCCGGCAGTCCAGCCGTTTTTCGCA
CTCGGGGTCACGAGCTCCTTGAGCAGGAGGCCGTCAATCGGTGCCGAACGACCCTGTTGATCCGTGCTAGGACGTCCGTGATTTGGTATTTAGTGTTCAATTCGAACCTCACGTTTTTCT
TTCCGAGGTGTGTTGGGTTTCGTCACATGTGTTGGGAGGGGGGGCTCATGCATGAAGAAAGAAGAGAACACATAATCGTATTGCTGTTGTGCCATTGTGTCACTAGAGACAGGAGGTACT
GACGAAAATGAGCCCCAGTACACGTGCTGCGGGGGGTTGACAGTTCTGGAACAACGGCGTGGAAATATATTTTTTCCTATCTGAGATGAAGACTGGAGAGATCATGGTTCGACCACCCCA
TCACCGACCACCCGGTGCCCGTTCGATTGGTTTTGTGAGGGTTTATTGCGAACGTGGCAACAAGCAGAATTAGAGTTGTACATCGAGTTTTACATCGTGATCGTGGGAAACCTGTACAGG
GGCTCCTCGTGATGGTGTACAACCGTATTCGGATGCCGAATAGCCCTGACGTCGGTTGGACGGTCTCAACGCGAAGGTGCTGTCCTTGACGCTGATGAGAGTTACGTACAACAATTCCTG
TTTCCAGATCTACAACCACAACCTCTACTGGAACTCTCTTTCGCCTAGCGGCGGCGGGGTGCCGGAGGGGGATCTCTACACCGCTATCCAGTCGGCCTTCGGCAGTTACGAGGAATTCCA
GACAACGTTCACCGACTTGGCCTCTGGACACTTCGGCAGCGGGTGGGCCTGGCTAATGATGCACGAAGATGGCTCCGTGGAT
GTGAGGAAACAAGAGAAACATGCTGTTATTCCAAGGCG
TTCTGTCTGAAACGTGTGTGCGCCGGGGGGGGTCCTAGTTGTCAGCGTTACCATGGAGAGACTTTCGACAATCCTGCTGGCATACGGCAAGCCCTAGTCTCGACACCACTCTACATTTGT
ATGTTCCAGCATGGACCCAGTCTTTTCTCTCCCTGGGGATAGCCTCCTACCTCCTACCCTAGACAGAGGCCATGTCCCCTAGCCATTTCTATGAATTCTCACCAGCTGGCAACAATGGAA
ACAGCAGTACTCTCGATGCTCATTCGTGAGGTGCAGTCGTGGCTTGTTCGTGCCTTCCCGCTAGCCAAGACAGCCTAGCCGGCGCTTCGTGCTCAGCCTCTACACTGGTTATCTCACAGA
TCAACCATGACCTTATCGTACAAGGCCAAATCATCGTTGCCACACGTCTCTGCTGTGATGAAACATGCCGCTTTCGATGTCAATCCAGGTGGTGGACTCGCACGATGCCTCGAACCCCGA
GAGCGATGGACTTGGATTCCCGCTCCTGGTCTGCGACGTTTGGGAGCACGCCTACTACCTCGACTACCAGAACTTGAGGGCCTCCTACATCGAG
GTGCGACCTTCCGCAGTCCTCGTCGC
AGAGCACTCCGTATGAAGTGTTTCACGCTGGATGCCTCTTTTCGAGTCTTGTAAGATATCGGTATCATCTTCTTGCCCTTTGTATTGTCTTGCGCGTAGGTTTCGGTGGTGCCGCTTTTC
GCGTGTCCGTTCCCTCCTGTTTCTGATATCCAAGTTCGTGCCGTCTTCGTTGTCCGTCCGGCTGTCCGATGCTTCCAGGGTTGGTGGGCTTTGGTCAACTGGGACTACGCTGAGTCCGAG
TACACCCGTGTGTTGGACGAATACAACAAGAAAGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTCCATCTCGAGCTCGTGCTTCGCCCTCTGGGGAGGACTGCTGTTGATCCCCTTCTGTCCGCAGGGCTATGGCCAAGTTGAGCTCCCCGCCTTGCCGTACGGGGAGTCTGACCTT
GAGCCGTATATCACCGAGGAG
ACCGTGGGCTTTCACTACGGAGCGCATCACCAAGGATATGTGAACAACATGAACGCTTTCATCGAGGCTGATCCTGATCTCGAGGGCCTTTCCCTCTCG
GCGCTCATGGACCAGACCGAGGGGACAATTTTCAACAACGCCGCCCAG
ATCTACAACCACAACCTCTACTGGAACTCTCTTTCGCCTAGCGGCGGCGGGGTGCCGGAGGGGGATCTCTAC
ACCGCTATCCAGTCGGCCTTCGGCAGTTACGAGGAATTCCAGACAACGTTCACCGACTTGGCCTCTGGACACTTCGGCAGCGGGTGGGCCTGGCTAATGATGCACGAAGATGGCTCCGTG
GAT
GTGGTGGACTCGCACGATGCCTCGAACCCCGAGAGCGATGGACTTGGATTCCCGCTCCTGGTCTGCGACGTTTGGGAGCACGCCTACTACCTCGACTACCAGAACTTGAGGGCCTCC
TACATCGAG
GGTTGGTGGGCTTTGGTCAACTGGGACTACGCTGAGTCCGAGTACACCCGTGTGTTGGACGAATACAACAAGAAAGACTAA

Retrieve as FASTA