Entry information : EsilMSD03 (Esi_0342_0001)
Entry ID 16947
Creation 2021-01-30 (Christophe Dunand)
Last sequence changes 2021-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilMSD03 (Esi_0342_0001)
Name (synonym) EsilMSD03 (Esi_0342_0001)
Class Mn SOD    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilMSD03
start..stop
S start..stop
CbraMSD01 75 8e-17 14..168 76..232
AtMSD01 66 0.00000000000004 1..132 1..121
EsilMSD02 66 0.0000000000001 34..128 33..114
KflMSD01 65 0.0000000000001 15..132 7..118
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5152..5313 162 N° 2 3409..3550 142 N° 3 2510..2625 116 N° 4 2344..2433 90
complement(join(2344..2433,2510..2625,3409..3550,5152..5313))


exon

Literature and cross-references EsilMSD03 (Esi_0342_0001)
Protein ref. GenBank:   CBJ32474.1
DNA ref. GenBank:   FN648534.1 (5313..2344)
Protein sequence: EsilMSD03 (Esi_0342_0001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18400.17  
PI (pH):   %s   8.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMGKKSSTPTLVGRCLALSTLAAVGASAQNLPVPPLPYSYGSLVPFISEHALRVHHLGHHAAYTSQLNAVLERMRWDPELKHLAKMGVDELLHNLGSVPEDYRAAARRAGGGFVNHDLFWNVLSPWGGHPPGQESDTIETWWLSSCFSSSSSSWSYRRVMQAGYLAA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGGGAAAAAGAGCTCGACGCCGACGCTGGTAGGACGATGCCTCGCCCTGTCTACGCTGGCCGCGGTTGGCGCGAGCGCCCAGAACCTCCCTGTGCCTCCCCTCCCCTACTCG
TACGGATCCTTGGTGCCCTTCATCAGCGAACACGCGTTGAGG
GTGAGAGAAGGCCAGCATTCTTCTTTCTGCTGTAGACTACGGGTGTTCGTGTTTGTGTTTTGCGTGTGTTTCTTCTGG
TAACATGGACCGCGCTGACCCGGCTGGCCAACGGAAGTACTTTTTTTTGGTTTATTGCGGGTGTAGTCTATGCACACCATGTGTGGAGAGAGGGTAGCTCGGCTTGACCAAGGCAGGCCG
AGTGGGTATTGTAGTTTAGTGGAAGTCTTGTGCTGTGGAACGGAAGAGGCGGGTCCTGGTGAGAATCTGGCATGGACAACGCACCAGAAAGATTGCCTGTAGAACTAAACTCCAGACGTC
AATGTCCACAGGTCTACCCAAGGAAACCAAACTCTTTTTTTGGAATATGCCACTCGACTGAACCTATCCACCTGCATTTCGTAGTACATGCACTTTCGCGCCAGTATCCATCCGTGCTAC
AGTACTATGCCACGAGCATGTAATATTTCCAACAAGTAGTGCGTGCACAAGGGCCACACATGTCACGTACTCGGATGCACGGTTTCAATAGCAGTACTCCGTACAAGATATGTACTGCGG
CAAGAAGTACAACAACGCTGTTCAATATGCCTTTGCCGTGGTCTACATCTACCGGACGTGAACACATAACAAAATTATAGCCTCAATCATGGTTGATTCGTGCTGTGCGTCTTTTTCGGC
ATTGACCTCTCACTCAAGTTGTCCTCTACCATGGGAACAAAACCGTGCGTGAGCCCGGTGACTAGATACGTATACATATATTTCTCTCATACAGCAGTCGTGTGCATAGGCCCTCCATAT
GGCGAGTTATATAAGGCGAGTGCCCCAATATGGCGGGCTATATAAGGCGGGTGCCCAAATATGGCGGGTTATACAAGGCGGGTGCCCAAATATGGCGGGGTAAAGTTGGCTGGCGCAGAC
GGAACAATTAAGTTAATCTACACATTGAATAGGGCGGGTGCCCTGTATAGGTCGGGTGAATCGGTCTGGCGCATTCCCGCCTTATAGAGGGCCTACGACTGTATGCGTTTATGTTGTTTG
CGGGTCCCCCCGGGCGGGGAGCCAGCCCCCCCGGAGAAAGTATCGTATCGAATGATTCAGCGCCGACGAGGTCCGGGCACAGGGAACGGTAAACACCGGTACCCGCATACTCTACTACCT
GCCCGCCTAGTTTTACGGTGGTTGTGTTGAGGAGTAGTATGCCGGTTCTACGTTTGGTGTCGTTCCCAGCTCCCGGGTAAAATCTCCGCCTCTGTCTCTACCGTACAGCAGTCCAAGTAT
GCTGTTTCCTGCCGTGGTCAGTGGTTCTGGTGGAGGCCTGGTGACGCACTGAAAGTTCGGCTGCATTTTGTGCCGCTGTCTGCGTACATGTACATGGCCGTTAACATCTGGGTGTGGGTT
GCTCCCGGCCGTTCTCCTGGGAAAATGAAGTGTGTGCATAGCAGCCTTCCGTCTTTTCTGAGGATGATTTCCACGGCCCTTGGTGAACCCCACCGACCTGTTGAGCTGTACTTGCCTTCA
CGCATCCATCATGCCAGGGCGTTCCTTCACGACGCTCCTCTTTTCGCGTTTTTGTCGTTTGTGCTGTTGCATTCTATGTACAGGTCCACCACCTTGGACACCACGCCGCCTACACCTCGC
AGCTGAACGCCGTGCTGGAGAGAATGCGTTGGGATCCGGAGCTGAAGCACCTGGCAAAGATGGGAGTAGACGAGCTGTTGCACAACCTGGGGAGCGTGCCGGAGG
GTGAGAGAGAGGGAG
ACTTGGCGGGGTGGGAGGGGTGAACACACAAGCGCGCATCCCGTAGTCGGTAGGCCGTTGACCTCGCACCCATACAAAGCCGGGATCGGGTACGGATCACGGGTTCTCACCGGACCAGGC
TCTCATATCACCAAGTGCGAAGCACCGTGAGGTGTTCGGCGAGTCGCATGAATGGTGCGCTGCATTCTATGAAGGATATTCTGCATCTTGTGCTTGCTTCCTTGCGTGCGGTTGCGGCCA
CGGGGGAGCGGGGGGGGTGAATGATGGAGGGTAGCAAAATGCAGCAGCGGGGACTGAACACGAGGGAGTCTTCTGCACGAAACGCATGGAGACAGAGCGGTGGCACATTGGTAGGTCTAC
GTTAACTCTTCACAATCAGCTGGTCCCAAGGGACAACGACTGGCATGAAACGCGTGCGGTGTAAAGGGAGCGCGCTGCTTCCGGATGGTTCGCCTGCAGCCTGAACAAGATGCACTTGAC
GTGCACTCGGTGGCACGCCCTTTACACCAAGAAAGAGTCTGTAATTTCCCTGGCTCAGTTGCTTGTTTCCGTGTTGGCTTTTTCTCACGGCTGTGGTACGTCGATGGTTTGTTGTGTTTG
CCGCATTTGACCAACGCCAAACGTACAACACCGAACCGCTGCATTTTTTGTTATGTTTTTTTCGTGGTGCTTTTTCGGTGGTCGCCATTTTTGGCTACTGCTGCCGCTGCCGGGGAATAC
GGGTGGCGGTTATTTTTTCTCGGGGGGGTGGATGGATGGCGCTGTCAGACTACCGGGCGGCTGCTCGTCGGGCGGGGGGAGGGTTCGTGAACCACGACTTGTTCTGGAACGTGCTGTCAC
CGTGGGGGGGACACCCTCCAGGGCAAGAGTCGGATACTATCCAG
GTGCGTCCTCGAGAGCAAGAGAGCGAGAATCGAGAACGTTTTTTGTTTTTTTGCCCTTTGTCGTTTTGTGGTGCAG

GAAACGTGGTGGTTGAGTTCTTGCTTCTCCTCTTCCTCCTCCTCCTGGTCGTATAGGAGAGTTATGCAAGCCGGGTATCTGGCGGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGGGAAAAAGAGCTCGACGCCGACGCTGGTAGGACGATGCCTCGCCCTGTCTACGCTGGCCGCGGTTGGCGCGAGCGCCCAGAACCTCCCTGTGCCTCCCCTCCCCTACTCG
TACGGATCCTTGGTGCCCTTCATCAGCGAACACGCGTTGAGG
GTCCACCACCTTGGACACCACGCCGCCTACACCTCGCAGCTGAACGCCGTGCTGGAGAGAATGCGTTGGGATCCGGAG
CTGAAGCACCTGGCAAAGATGGGAGTAGACGAGCTGTTGCACAACCTGGGGAGCGTGCCGGAGG
ACTACCGGGCGGCTGCTCGTCGGGCGGGGGGAGGGTTCGTGAACCACGACTTGTTC
TGGAACGTGCTGTCACCGTGGGGGGGACACCCTCCAGGGCAAGAGTCGGATACTATCCAG
GAAACGTGGTGGTTGAGTTCTTGCTTCTCCTCTTCCTCCTCCTCCTGGTCGTATAGGAGA
GTTATGCAAGCCGGGTATCTGGCGGCATAA

Retrieve as FASTA