Entry information : EsilGrxC01
Entry ID 16949
Creation 2021-02-02 (Christophe Dunand)
Last sequence changes 2021-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilGrxC01
Name EsilGrxC01
Class CGYC Grx    [Orthogroup: GrxC005]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilGrxC01
start..stop
S start..stop
HaGrxC03 103 1e-29 36..153 12..123
PpaGrxC03 103 3e-29 28..155 1..128
PpaGrxC02 100 1e-28 67..155 10..98
KflGrxC01 100 3e-28 67..149 24..106
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 290657..290703 47 N° 2 289847..289963 117 N° 3 288904..288981 78 N° 4 287518..287591 74
N° 5 287017..287063 47 N° 6 286340..286444 105  
complement(join(286340..286444,287017..287063,287518..287591,288904..288981,2898 47..289963,290657..290703))


exon

Literature and cross-references EsilGrxC01
Protein ref. GenBank:   CBN75201.1
DNA ref. GenBank:   FN648949.1 (290703..286340)
Protein sequence: EsilGrxC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   155
PWM (Da):   %s   16410.21  
PI (pH):   %s   8.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRPVLNLFFLFGSSVGFYANPMMRRVAVSSFAGSTIVRAASATAFPSQRQAKFTTSMNSVDFVEKEIDSNNVVVFSKSYCPFCTRTKNLFAGLGVDATVYELDQDDGEAIQAILGAKTGTTVPNVFVKGTHVGGNDAVQAANSSGALKTLLDG*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCCGGTCCTGAACTTGTTCTTCCTCTTTGGCTCGTCCGTTGGGTAAGTGATATCGGTACAATATGCAGATGATGGCAGATGCCGCTTTGCAGTGGCAAGAAAAACCAGCTGAGAA
AAACGAAGTTCCGACATGAAGAGTGCTCTCAGCTCGCCTCATCATGCACGTGCAAGTGATGATGCTTGCGAGCATGCTACGATGTGAGGGCTCACGCAGGGCGTTAAATGAGCCTGTACG
CCTCTAGTGCAAGGTGTTCACTATTCTTCAATGCCTAAATACTGGCAGCAAAACATGACCACGATAGGCACCATGCGGCACCATTGTCGCTTCAGTCATGGTGAGCTTTAGCTTCACCTA
TGATGCATATGCATCGCAGATCAAACGCAGCAGCATCGGTCTACGAAACGACCATCGCTTCACCAACATACAAGACTATTAGCAGTGATATACCCCCCGCTGTTGACGATTGTGGTCGCT
TGTGCTCTCTTCAGAGGGTTGCAAACTTTTTGGGGTGCAGTGACCTTTCCCCGAATTCACGAGCACACCCACAGCACTAATCGATTGATAACATGATTACTTTCTCTGTCTCTTTGTTCT
CTCTCTCTCTTTCTCTCTCTCTACTATGCGTATGTCGTGTCAATTATGCCTGTCTGCCGCACTCTCACACCCGTTGCCCTCTCTCTCTCTCTCTCTCTCTCTCTCTCGCTCGACCTCACC
CTCCACTACTTCTGTGCCAGGTTCTATGCAAACCCCATGATGAGACGGGTGGCGGTTTCTTCCTTCGCAGGCAGCACAATCGTCCGAGCAGCGAGCGCTACCGCCTTCCCAAGCCAGCGA
CAGGCAAAGTTCACCAC
GTGAGTTCCCAAACCCAACTTACCCAACAGTAGCTGTCATCCATGTGTACATGTACATCACACCGCTTCCTAGAGTTTTTCTATAGAGAATCTGGTATTCCGG
TGAGGCCTACATGTGCATTTCACATTTCACCCCTCGACACATGTCCAGGTGCCTTCCAAGCGGTACTTTAACATTTGATGTAGCAGGTTCACGTGTAGACGTGTAAGGAGGAGTCCTTCC
CTATTTCGCCGCGAAAAGGTCTGCGGCAGCTCTCGAAGCCACCACGTTCACGTGCGATGTTTCCCAACGTAAACAAAACCATAGTGTGGGCGCTTTCTGTGTCAACCCCTCCGTGGTCTA
AACAATGGTTGTCGAGGTCGCGAGATCGAATCTTGGTCATCGCTACACCGTTTTGAACGGTGTTCAATCCTTAGAATGCTCGGGGTTCGGTGGAGACGTTGTCGAGGGAGTGTATCCCCG
AAACTCTGTCCGGAGTCCTTTCGAGTGACCCCAGGCTGATCCGCCCTCCAGGTGTACTCGAACATTTAAGGGCTTGCCGTCCAGATTGGATGGGCCGGGAACGAAACAACTGACGACTAG
ACTACTGCTGTGCGCTTTTCCAACATTTTGCAGTAAGACCAGAACCGCCAGTAGAAGCAGCGACGAACCGAATTCACCACCATTAGAGGGCCTCTCGATCCCGAACTCACCCGTACCGTG
GGCTCATTCATGACGCTTGTGCCAAGAACAATCGCCACCATCATAAAACACGAAAACGTTGGCCAAGAGCCCTTCTTTGGGTGTTGGCTGGGGGGTCTTTGACCACATTCGGATTGTCGT
TACACACGCGTCGCCTGTCTGTCCTCCTTCCCTCCTCGCCAGGTCGATGAACTCGGTGGACTTCGTGGAAAAGGAGATCGACAGCAACAACGTGGTTGTCTTCTCCAAGTCGTACTGCCC
GTGAGTGCCAGCTGCGGTTATTTATTGCTCAAGTGTAAATAGTCATACGAGCCGCCCCTGAGCGCGGTGGCGGCAGCAGCCGCAGCTGATAGGAAGCGCGTCACACCAACCCCCGCGACG
CAACAAGCGTACATGTGGTGGCCTGGGCAGTTGCGTAAAACAAGTCACCGTGCGCTCCAGTGCTGCGTTTCCTGCGAAGAACGGCATGGTTAGCTGGCAAGACGTAGCATGCAACGCACG
ACCGCTGTGGGTCGCCTCCGATTTCTCGTCCTCGCACCCTCCCCCAACATGAATGAAATCTTGCTCAACAATTGTTGCAACTGCTTAGTGACGTCTGGAAACCGATAGGCCTTACCCGGC
AATCGCTGCGGGATCATGTTTTGCTGGTTGCATGGGCCGAATTTTCGTTTGCATCAAGTTGTAGAAGGACCAACCTGACGAGAATGGCAGTACCACTTACCACCAATAGAAATAGCGTGG
AAGTGAAACTGGAAGGTTCTCTTCGTTCGGATTTTTATGCCATGGATCTTTTTATGCCATGGATCCAGCCACCGAGGTCGCCTTCATTTGTCACTGGAGCTTGCCTCGTAACCTGGCAGG
CGTTCTTGTACTGTGCTCCGTCCGTCGTCGCCCCCCCCCCCCCCCCCCCCCCTTTCCCCTTCCCCTTTTTTTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAAAAAGTACCATCCAACCCCCGCCCCGGTGGGGTTGCCTCCGATTTTTTTTCCTCCCCCCCC
CCCCCAAAAGAAAAGAAATTTTTTTCAAAAATTTTTGCAAATGTTTTGGGGGTTTTGGAAACCAATAGCCCTTCCCCGCCAATCGGGGGGGGATCCTTTTTTTTGGGTTGCAGGGGCCAA
ATTTTTTTTTGCCTCAAGTGGTGAAAGGCCCCCCCCGGGGGAAAGGGCGTTCCCCCTTCCCCCCAAAAAAAAAAGGGGGGAAGGGAAAAGGGAAGGTTTTTTTTTTTGGGGTTTTTTTCC
CCGGGTTTTTTTTTTCCCAGGGATCCCCCCCCCGGGGTCCCCTTCTTTTTTCCCGGGGGCTTCCCTTTTAACCCGGCGGGGGTTTTTTTTTTTGGTTCCTTCGTTTGTCCCCCCCCCCCC
CCCCCCCCCCTCTCTCTCGTTCCTCTTTGTTTGTTCGTTCGTTGATACCACCGCACGTGCGCGTCTTGGTGTGTCTGTATGTGGGCAACGACGACGACGACGACGGCAACAGCTTCTGCA
CCAGAACCAAAAACCTCTTCGCAGGGCTGGGAGTTGACGCAACGGTGTACGAGCTAGACCAGATGG
GTGAGTCACCCAACCCAAAGCGGTTACTGTACGCGCACCCCTTCTTCTTGCTGT
CCGCGTTACGGTAGAGCGTGGCAGCTCGAGAAAACCCGCCCACGCCGGTGGGCATTTGCCATGGCTACCGCTTGCTCTGTGCGCGTTGGTGATGGTGGTGGTGGGCCTCGAACGGGCTGT
GTGCTACGTGTTTTGCGGTGATCTGCGTACGGTCTTAGGTTTTGGCTGTAGGTGTGAAGTTGGCGACTAGGTTTTTGCAGCCCTGATTGTTTTTTTTCAGCATATTTTGCTGCGGGAAAG
AACGCCCGCACGCAAGGCACATCGCGCAGCCTTGACCTGTGAACGGCGCGGAGCAGCGAGCCCTCGAGTCGCGGACCCAGGCTGTTTTCGAAGTTTCACACGCACGTCGTGCTCGTGACC
CCCCCCCCCCCACCTCGTCTCTACCCCTGTGCCCCCACAGACGACGGCGAAGCCATCCAGGCTATTCTCGGAGCGAAGACGGGGCAGGTAAGAACGGAGAAGGGGTGCATAGGAATGATA
CATAGCGCGGAAAAAAATGATACGTCATGAGAGGGACGAGCATGAAGCTTCCAATCCCCGATGTGCGAGGGGGTATTTTGACGGGAGGACCGGACGGAAAGCGCTTAGTCACACGCTTCA
GAGCCTCTTCTGGGTTCACCACTTGCAGACTACCACAAGGTTCTTGTCAAGTTTGAGCGTGTGTGTACGGAAGCAACGTGCAGCTGCAAGTGATAGCTTTTGTGGTTCTTCTGTCGGTGG
CGTGCGCCAAAGGAAGGCTTCATTTAAGACCTTGCCCATCAGGCAGCGTCGTGATTGTTGCGTACGCCGCCGTCGCTTCTCCTCCCAGCCACCACCCCCAAACGCACCCCCCGTGCTTGA
TCTTGCCCTCGTACGCGTTCGGATGGCCCCGGTCTGTTCCTAAATAGTGCAAAACCGCGTGCGTCGTTTGCTTGTGTTGGTTGGCACCGACTGCGCTATACATAAACCCAAGCAACCCGC
ATGCTTGTTTTGTCTTGAATTCTCCCGCCCCGCCCCCCCTTGGCCCGTCCTCCGAACAGACCACTGTTCCGAACGTGTTCGTGAAAGGCACGCACGTCGGGGGTAACGACGCCGTGCAGG
CAGCCAACAGCAGCGGCGCCCTCAAGACGCTCTTGGACGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCCGGTCCTGAACTTGTTCTTCCTCTTTGGCTCGTCCGTTGGGTTCTATGCAAACCCCATGATGAGACGGGTGGCGGTTTCTTCCTTCGCAGGCAGCACAATCGTCCGAGCAGCG
AGCGCTACCGCCTTCCCAAGCCAGCGACAGGCAAAGTTCACCAC
GTCGATGAACTCGGTGGACTTCGTGGAAAAGGAGATCGACAGCAACAACGTGGTTGTCTTCTCCAAGTCGTACTGC
CC
CTTCTGCACCAGAACCAAAAACCTCTTCGCAGGGCTGGGAGTTGACGCAACGGTGTACGAGCTAGACCAGATGGACGACGGCGAAGCCATCCAGGCTATTCTCGGAGCGAAGACGGGG
CAG
ACCACTGTTCCGAACGTGTTCGTGAAAGGCACGCACGTCGGGGGTAACGACGCCGTGCAGGCAGCCAACAGCAGCGGCGCCCTCAAGACGCTCTTGGACGGCTGA

Retrieve as FASTA