Entry information : EsilGR01 (Esi_0019_0176 / GSR)
Entry ID 16967
Creation 2021-02-03 (Christophe Dunand)
Last sequence changes 2021-02-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilGR01 (Esi_0019_0176 / GSR)
Name (synonym) EsilGR01 (Esi_0019_0176 / GSR)
Class Glutathione Reductase    [Orthogroup: GR001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilGR01
start..stop
S start..stop
EsilGR02 584 0 1..480 47..524
LeGR04 347 2.54e-114 18..469 77..531
AtGR02 340 1.81e-111 18..469 85..539
ThasGR02 334 2.16e-109 19..469 87..538
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16967' 'complement(join(992998..993114,993761..993892,994785..994937,995367..995492,996596..996684,997195..997333,997592..997772,998550..998680,999616..999768,1000889..1000957,1001463..1001596,1003701..1003725))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1003701..1003725 23 N° 2 1001463..1001596 132 N° 3 1000889..1000957 67 N° 4 999616..999768 151
N° 5 998550..998680 129 N° 6 997592..997772 179 N° 7 997195..997333 137 N° 8 996596..996684 87
N° 9 995367..995492 124 N° 10 994785..994937 151 N° 11 993761..993892 130 N° 12 992998..993114 115
complement(join(992998..993114,993761..993892,994785..994937,995367..995492,9965 96..996684,997195..997333,997592..997772,998550..998680,999616..999768,1000889.. 1000957,1001463..1001596,1003701..1003725))


exon

Literature and cross-references EsilGR01 (Esi_0019_0176 / GSR)
Protein ref. GenBank:   CBN74340.1
DNA ref. GenBank:   FN648364 (1003725..992998)
Protein sequence: EsilGR01 (Esi_0019_0176 / GSR)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   482 (363)
PWM (Da):   %s   50976.48 (37965.4)  
PI (pH):   %s   6.06 (4.15) Peptide Signal:   %s   cut: 19 range:19-381
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSAEATGETPLGGPGGHYDYLVIGGGSGGVSSARRAASHGAKVA
LIEGTPN
GGTCVNVGCVPKKVMFNAAHINEMLHASKHYGYTVGETSFDWGKLKEMRDAYVRRLNGIYHRNVEKSGVTLVYGMAKFVGPKKAVVEGVEYTADHVMIAVGGTPSMPDVPGA
ELCIN
SDGFFDVTEQPKKVAVVGAGYIAVELAGIFDALGTETHLFIRHERAMRTLDPLLSDILDLMARAGLAVHKNSTTEKITKDEATGKLTLHTKDGHALGDLDVVLMAIGRSPNVGSL
GLPSAGVEQSERGHITVDEW
NTSAEGVYALGDVTGRVELTPMAIAAGRTLSDRLFAGMKDAKADYTNVPTVVFSHPPMATCGLTEPDARAAYGEDAVKVYQSKFTNLFFGHWQMPPEDKE
KTAMKVIVTGESEKVVGIHIIGMGADEMMQGFGVAMK
MGCTKADLDSCVAIHPTASEELVTLAPWGLENGKRSGV*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCCGAAGCAACCGGTGGTGAGTCAATCGCATGGGAGCAAAACAGCACCGCAGAAAGATTCCCCTCCCCTTGTTTGCAACATCAAAGCGAGTGCACCCACCATGTTTGCACG
ACGGTATATTACTGCGGGTATGCCACTCTCTAGTGCGGCTAGGCTCTAGCTTTCTGGTCGTCGCTGTCGTCCTTACCTGCTTCCCTCGTTAGGGCTTGGGGTTCTAGTCTCTGCTGAGAG
TCGCATTCTAAGCTGCGAGAGCGCAGGGTGGGCTTGTTGTCTTGTCTGCTAATACGGTAACTACCAATGCCGATGCGGGACGAAAACAGCCAATGCTCGGACAAATAGGCGCCCCTTTTG
TACCGAGTAGCATCAGCAGTTTACCTCCGTTTGCTTTCGTGTGGCGCCTCTGCTGCTGCCGAAGCGGCCACCCGCAGCAGTAGAATAAGAGCTTCAGGGTTCTTCTCTGCTCTCACGTAT
GGAACGGACCGTGAGGGCATACGCGTGAAGATTGGGTGTCCCGAGATGTTGTAGCAATTGCGCCGCTTTTTCTGGGAGCATCAAGTGGGCAAGCTGCAGCTTTACTATTTTCTCGCAACA
TTTCTCGGGGCTGTGCTTTTCTCATGGTACACACGTTGTGGTACGCTATGGGAACAAAACTGTGCGCTGAAAAGGTTGGGAACTCTTGTTTTTTGACAACAATCGCGCGATCTGGATCAA
AAGTTCACGAACTTTTCTCGCGACAAAGTGTCGAAAATATGTTGTAGTTTCGGCGAGAGTGTAAAGGCTTCAAACAGACTCGGAATAGGCCCGGTACAGCAGTAACCAGCTTGTTTCCCT
CCACTTAATGCAAAGACTTCAACACACCCCGTTCGGCTGCTGTGGTTAAATCTCGAACGTGTGTCTGTGTTGGTTGTATAGTATTTATTTTTCATGATGGTTTCGCGGCGAGACGTCCGC
CAATCCACGTCGTCAAGCACCTACCCGTACGACACACGTAGACCCCATCTCCAGCTTCGACAGGAAGGCACCGTCCGTGTTCACCGATATCTGGACGAAACCTAAGCGAGTGACCTCGTG
AATGGCATCTGGAAGGAGGTGATGCCTTGAGCTGTTGGGCAATGCCAAGTTTGGCGCCATGAGGTGCCGAATGCGCCGGGACAAAAGTTTGTTGACGCAAGAATGTCAACGGCCACCAGC
GGTGCCAGATGAGAAACGTAATCGCGCTTTCCTATCGAAGGGTTGTACCGACACAGTAGTGCGTGTTTGTTTGTTGTTGGCATCGGCTGACCAATGAAAACACGCGAGTCTCAGTGCGGC
TGAACACAGAAAGCGCTTCTAAAAGGCGAGATGGAGAGTTGATGTACTGTGGTGCGCCCGCTGCGTGGGTTTGTTTTTAAGTGAGGGGGGGCATCAGACACACACACGAGACGGACGTAT
TTTCCTTGGTCAGCCGGTTAGCGCTGTCGATGCTAACAATAGAAATACACACGCCCCCCTCAACGGGGTCAGTCCCAGATCATGGGCGGCGTCAGGCTGAAGCCAGCCTTGGCTTCGTCC
CTTGATTCATATCCCTGCCTCACCCGAAACACATGCTGAGTTCATTCGCATGCATGTCCGCATCTCCCTTGTAGTAGCTGCTAGATCAACTCGTTTAGAGCGGCTCGCTGAAGGATGCCA
TGGCAGCGTTATTTTTATGAAGTTGAAAGTTTTTGTTTAACTCATGCCTCTTCCATTCCGGCAGGTTGTGGAGCGGACGCCGAAGACATGCGGTGGTCTGAATAGCTGTCTCGTTCCCCA
CACGCACATTCAGAGTCGTAGCGTCTCCCTCCATTATTTTCGTCGTTGGCTGTGTTCACCATGTAACAGACCGTGCCGGCCCTACTGCACCTCTCTCATGAACCAACCTCGGCCGAGCTG
CAGGCAGACAATCCCGGCAACCTTCTGTGGAAAGAAGCATAACGCCTCAAGGTCGTTGTTCACCTACATGCTTCGGACTCCCGGGTGGTGCGATCTGCATATGCAGGTTCCGAATGGCAA
CTGACGGCGTTAATATGTAATTCGTGACCGCTTATTATTATTATTTAGTTCTTGGATGCCCATTTCGCCGGATTTTCCTTGCCCGTCAGAAAAACGCCCCTCGGGGGGCCCGGGGGACAC
TACGACTACCTCGTCATCGGCGGGGGCAGCGGAGGCGTTTCCAGCGCCCGCCGGGCCGCGTCCCACGGGGCCAAGGTCGCCTTGATCGAAGGCACCCCGAACCTG
GTGCGTGGCAGTCGC
GTGATCGATGATCACGGATCACAGCAGCAGCAGCAGCAGCAGCAGGGAGCAGCAGTCGGTTCGGTCGGTCGATACCTTTCTTTGTTCAGTGGTTTAAATAGGAGCGGGGTGTTGTTGTTG
TTGTTGTTGTTGTTGGTGGTGGTGGTGGTGGTGGTACTGGTGGGGGGGGATTGGCGACAGACTTTGGTGATAGGGGCGGGGGTGGGGCGTGGTGGTGCTGACTCGTGTCGTCGCTGTCGA
TGTCATTGTTGGGTGGTGGCGTTGGCGGCGTGTGCGAGCGGTAGTGACGGTCATGCTGGAAAGCTTAGACTAGTCGTTGATGCCTCCTGCGAGGAGCCAACCAATCCAAATGTGCAAGTG
TGCAGCTTTGTGACAGGAGGCAATAAGATACATCCCTATTTCACGACGCCTTTTTGTCGGCGGTGCTTGACCACCGATCTCTTGCCCCGTCCCCGACCGTCTTTGTTGTCTGCGTTGTCC
AACATGCCAGGGGGAGGGACTTGCGTTAACGTGGGCTGCGTGCCGAAGAAGGTCATGTTCAACGCCGCCCACATTAACGAGGTGGGTGCCGTGTTGCAGGAAAGGAGGCACGACGTTTCT
GACGCGTACATACTGCGACAGCTGTGATACGGGCATGACGGTGCACACGCTGCTGCTCCCGTCTACCGTATACCACGACACAAGATAACAGACACACCCTGGACCGATTTTCAAAGATAG
ATTACTCCACGACGAAGAGGACATACACGAAACGATAAGTTTTCGGAGAGCTCTCGACCAGCCGCCTTCAACGCCGCCGTTTTCGCCGCCGCCATTCTTTGTCTGCTGATTTAATCGAGC
TTTGAAAATCGGTCCAGGGGGTGTGTTATCTTGTGTCGTGGTATACGGTAAGCTCGTGCATTGCCGCACCCGGGGAACGTGGCCTGAACCATGCGAGAGTCGTACTTAGTGCGGGGACTC
TTGTGGTGGAACCCATGCACAAAGCAGCGAGGGTGTTCATGAAAGGTTAATCGGGGTTTGACGCAGTACATTACACTTCAGTGTGGCACTGCCTTCCTCTTGTGTGACTCTGGCTGGTGC
TTACAGAAATTGTAACGAGAAAGGTGTACAGACCGACGTCAAGAGTAAGTGGGACAAAAAAAAAAGTGCTTGTCGATATTTAGAAACAACCGTTTCTATCGCATTTCCATTGCTATTGGG
ACTTCCGCAGACCCGAGCAGTGTACGCACCCGTGAGCTTCTAGCCGTTAGGAATACGCCCTATCCAACCAAATGTTGCGCACGTCCAAAACTGGAATGGGATGGTGGGATGATGTTTTGC
TGAGGCTCGTTAGGTTGAGGCATGTATTCTCCACCACAGTGAATCCGTCCAGGCTCCCGCTACCCGGCACCCGCTCTTGACGACTTGACCTGCAACTGATTCTTTGTTCACAGCTCATCA
ACTGACGTGTCCTGCTGTCCAGCAGCAAAGCTCGACGCCCCGCATGTGGAAGCAACAGGCCACGGCGGTGAGGACTGCCGTCTCCTAAAACCCCCCGGCACGCGCCCTGTATTCCAGTCC
ATCTCATCCCCTCCACATCGCTCCCCAATCGTTCGCGTCGCCTCCTCCCCTCGGCGCCCTTTCACCGGGGAACGGATGCGCGTGCGTGTGATTGACGCGCGACGACAACACGGCGCAACA
GATATGCTGCACGCTTCCAAGCACTACGGATACACGGTGGGCGAGACGTCGTTCGATTGGGGAAAGCTCAAGGAGATGCGGGACGCGTACGTCAGGCGGCTGAACGGCATCTACCACCGC
AACGTGGAGAAATCGGGCGTCACGCTTGTCTACGGG
GTAAGGTTAAGAGTTCACCTATCCGGGGCATTTTTTTTTTATGGTTTCTTGGGCAGAAGGGCAGGGGCCAGGTTCATTCACCTT
GTCGTCGTTCCTTCAAAATGAAAACTCTGTAGGTTTCACGATGCCGTGTTCTCGGAGAACGGTGACAGGCGGTGTCATTGCGGATCGCAGCACCTACGGCGTTGGTAGAACAGGTACTGT
TTTGCGCGTGGAGGGACAAGAGGGCCCGCTTTCCCGTCGGAATAACTCACAGATTGTCCCGAGAGGCCATGTACAGGCGAAGGCCAATGCATGGAGCCAGGGGCGGCGGTGCCCGTGGAA
GTAGAGATTATGTAATATGCATTCACTAGAGAGTTTGACGAACGCATCGACGGAGCCCGAAGGGTACAGTATGCCTTTTGTACCAGGGGCAAGTTGAGATGAAGAGTTCGGGATAGACTT
CGCAGCGTGTTTTTTGGGGACGTATCTTCTTCGTTTCTTCTCTCCTGCATGCCCAGTTTTCAAGCAACTTTATTCTTGCCGCGATTTGTATCCAGCAGCGAAAGGGATTGCAGAACGGTA
GGAAAGCAACCGGCATTTTGTTTTTGCATTCGTGCTTCTCTTCTTTCGCCTTGACGTTAGAAGGACAGCCCACGAGCAACATTATGTTTTCCCCTTTGCCACACACCCCTCTTCATGATA
TGTTTGGCACTTTTGTAGCCCTGCCGTCGCAGCTTGGACAAATGGCGGAGGTTCACATCGCCGTCGGAACGTCCTACAAGCATGTTTTTTTTTTTATGGCCCTGTGTTGGGGATAGACAA
AAATATGCATACGGCGAGAAAAACGACCCCCCCGCTCATGATCTGTTGCTTTCATAGTTTAAGCACCTGAGGTTATTTTCTGTCGGTCGGTCTCTCTCTCTCTCTCTCGCTTTCTTTATT
GTGGTGCAAAGATATGGCCAAGTTCGTGGGGCCGAAGAAGGCTGTTGTCGAGGGCGTGGAGTATACTGCGGACCACGTCATGATCGCCGTGGGGGGGACGCCGTCGATGCCAGACGTGCC
CGGAGCGGAGCTCTGCATCAACAG
GCATGTGATGCATACCAGCCCACTCATTATTTATTTATTTTCTTTATCAATAGGCATGTTGCACATGCCATCACTTATGTAAAGATGTGTTTCTGC
ATCGACAAGCCTGCGATGCCAACTGATTTTTTTTTTTATCTCTCTGAATCATGAAGCACGTGGTGCACACCGCTCGCTCAGATGTTTTAGCAATACCTAGTTTGTGGTGCAACGTAGCAG
GTTGTTTAGTTTAGGCGCTCGTGCCGACTGTTTTCCACCTGGTATATTGTTTTGTCTCAGCCGCGACCTTGTGAAGTTGAATTTTGTTCTTGTGGCACTTGTCGCACTTGACCGGTTTTC
GTTAACCCACTGTAGCCCCGGTCGTGCCATTTTCTATCGTCCGCAAGCTGTCATCGCCGTGATTTTTTTTTCTCACTCTGCTGCTGGCTCCTGTGGTTTCGGTGTAGGTATGATGAACGA
TGAGTTATTTTCGTCGCGGAACAGCTAAGAAGCTGTCCGCCTGTTTCACTCGATCAAGACATGTTTTGTCATTGGTTCCTCTGTGTTTGGTCCATGTTCGTACCGTGAGCGTTGGGCTCT
TCGACATCACGGAACAGCCCAAGAAGGTGCCCACCTGTTATTCCAATCAAGCCTTATCTCATGTCTTTCTGTTTCCTCTGGCTTTTGGTATTCGCCAACATGAACGATGGCTTCTTGGAC
GTCTTGGAATCAAGCCCTTTTTTGCACTCTTCTTTGCTCTCTTTTCGCTATGTATGTTTTGGTACTTGTTCGCAACATCAGCGCGATGGGTTCTTCGACGTCACGGAGCAGCCCAAGAAG
GTGGCGGTCGTGGGCGCCGGTTACATCGCCGTGGAGCTCGCGGGTATCTTCGACGCCCTCGGCACGGAGACGCACCTATTCATCCGGCACGAGCGTGCCATGCGAACGCTGGACCCCCTC
CTCAGCGACATACTCGACCTCGAG
GTGCGGGCTCTTCGATTGTCTTTGTTATTGTGATTGTTATTGTTGTTGTTGTTTGTTGTTTTTGTAGCGCGTTTGCTGCTGTTGTTCAGTGGTGTG
TGTGTGGGGGGGTTCAATCTAGGCGCCTGGTCTATGGTCAAAGTTGCCAAAACATCTGAGCGTTGGGCGGTGGCGCCACCGCCCGTCTTCCGTTTTTTTTTTCTCTCGAGCACACGTTGC
ACCTCCTACACAACCCGTTCCGTTTTTACGTGTCGTTGGCAGATATGGCACGCGCGGGTCTGGCCGTGCACAAGAACTCGACGACGGAAAAGATCACCAAGGACGAAGCGACGGGAAAGC
TCACCCTGCACACCAAGGACGGGCATGCGCTCGGCGACTTGGATGTCGTCCTGATGGCCATCG
GTAAGAAAACAAGAGAGTGGATCTGTCGATCGAGATTCGTCGATCGAGACCTATCCA
TCGAGATCTGTCCACCGACTGGCTTCCTGTGTGTACACCCGAGTGCTCTGTTGGCCGTTCCCGGCCGGCGGCCCTTTGTCTGAAACCGGTTCATTGACGGATGTGGACTCAACTGCTACC
ACGTCTGTTGTTTAGATTATGTCAGCGGGGGCGTGGTTCCGGTGTTTCTTGTTGTTGGCCTTTCGGATGGCTTGACCCTCGCTGCTGCTGCTGTCTTGCATGATTTTGTGGGTTCGGTGT
TCTCCTTCGCCGTTGGAAGGGCTTGACCTCAAAGAGACTCCGCTACTGCCTGCCTGTCTCGCGTGATTTTGATTGACTGGCTTGGTCGTCGTCTCTGTTAATTGGAGCTGGGGATGGTGG
TGGGAGTTTGCTCCGCTCCTCCGCCTTGGTTAGTGAACGGCGGCGTGACTCCTTCTTGCCTCTCGTTTTGATTGGGTGATTGCTTGTTGCCAGGGGGAGGTCGCCGAACGTGGGGTCGCT
GGGTCTCCCGTCAGCCGGCGTCGAGCAGTCTGAGAGGGGACACATCACCGTGGATGAATGGCAG
GTGAGAAATTTGCGAGTGTTCGTAATGTTGTTGTTGTTGTCGTCGTGTATCCTAAC
GAACAGATGGCCTAAACAACAATGGTTGGGTGCGTTTTGGGTTTGGCATTGTTTTCAGTTTTACGGACGCAATGTAGGCCAGCTTGGGAAGCCCACTGTCGTTACTTTTTAGCCGGTCTT
TCGTTGCTGGCGCCACGCGTCCCATTTCAGATTCGACAGCGAACTCGATTTTTCAATGTGTGTGGGTGATGCGACGAAGCGCCCGCGGACGCACGACACGGAATGTCATATGACGGGGCC
TTTCTTCGGTATACCGGAGTTGTGTCACTGTTACGTAAAAAAATCTTGGTCAAGAAAGAGTACGTACAGCGCTCGCTCAGCTCCTCACACAAGCGAGTATGTACCGTGTAGCACCAACAA
CGTTTCTGTCGTATGCGGTGCGAGTTTCGCGTGTCTGATTGTCGGGGGTGCCTCGAAGGCGCAATACCGTAGTGTTGCATGAGATATCACACCCCCTGGCCAATTTTCAAAGCTCGATTA
CTTCACGACGAAGAGGGTTCCGAAATTGAAGCAAACGTTTTGGGAAAGCTCTCGACGAGACGGTTCCAACGCCGCCGTTTTCGGCACCGACACGGCTTTTCCTGCCGAGATATCGAGCTT
CGACAAGTGGTCAAGGGGTGTGGTATCTTATCAACCTACGGTAACCCGGCATGACCGACGAAAATACAAAAGTCTCGGCCGGGGCACATTAACCGGGTGCGGTTTCCGAGCCGCGGGTGC
CCCGTGGCGCGGGGGGCGCGCGGAAGAGATGAAACAGAAGGGCCCACTCTCTAAACTAGAATCCGTCGGTGAAGTGAGACACGGCAGAGCCTCAGTGTCAATGCTGCATCCTCCTGTGCT
GCTGTGCGTGTTCGCCAGGCACCTTAGCCAAGGTAGCGTTTTTTTGGGTTTTTTTCTGCCAACCCGCTGATTATGCGTCGGCCCTTTTTTCTTTCGGTACAATTCTGGACGGGGCCACAC
AGGAGGAGGTGCTTGTCTATGTTTTTGTCGCGAGATACAACATGTTTTCCTCCTGCGCGGACGCGCGCGCGTGTTGTTGTTGGCCAGAAAATACTAGCGCCGAGGGGGTGTACGCGCTGG
GCGACGTGACCGGCAGGGTGGAGCTTACGCCGATGGCCATCGCCGCCGGTCGGACGCTCTCGGACAGGCTCTTCGCGGGTATGAAGGACGCCAAA
GTAAGTGGCCCTACGCTGGAGAGAG
CTTTTTTTGCGGTTGGTTGGTAGGTCGTAGCCGTTGTTTTTGCCATCTTTCCCCGTTGTTTGCCGTTGCTGTTTTGCGTTAAACTGGCTGTTCTCGGGAGATGTTGTGACCGGTCGTTGT
TTCAGTCAACGATTCTCACATCAGATACGGCAATGGAATGGAAGGTGCATGCATTCATTCGCAAAACGTTGTTGTTGTTATTGTTGTCTGCCGTCGTGTCACCGTATCTTGTATTCTGCT
CGTTTTTTTTAACCCCTCCCCCCAGTGCCTCATGTTGTTTGACGGGCTAGACGAAGCCGGCGCTGCGTCTGCCGCGCGATCCCTACCCTCTCGCCCGAAGTGACCTGCAAATGTGTCACG
GAGCCCCCCCCCTCCCCCCCTCCCGGCGCGCCTTGTTCAATAAGGCGCGGACTACACCAACGTGCCCACGGTGGTGTTCTCTCACCCTCCCATGGCGACGTGCGGATTGACCGAGCCGGA
CGCCAGAGCGGCGTACGGGGAGGATGCCGTCAAGGTTTACCAGAGCAAGTTCACCAACCTCTTCTTCGGCCACTGGCAG
GTGCGTTCGTGCCGATTGTACCGCTCCGCGCATGGCGGGAC
CCGCCGGGGGGGTACTGCTGTCGCGATCGACAGCGTGCACAAGTGGGGCCCTCGGGAAATAATTTCAAATTTTCTTTTGCCGCTTTCCGCGTATGATTTTGGTTTTCGGGACGGCGTTTT
GACACAAACGTGTTGTGAGAAAAGTACCAGACCGAGATAAGTTCCATGAACCCGTAGTTTCGGTTGGGTTTGACACTTGCTGCTGCACAGCCTTTTTTTTATTGTTTCTGATTTGGCGCG
ACCAATGTTGGTTGTCTGAATGAAAAAAAACGGTGCAACAAGTTGCTTCCTTTTCCAAACTTGTCACTAGGAGCACGGCAGTCGCGTTAGGCGTTGGCGGAACGAGCAGTTCGCCGCATG
AGAGCGACCTTACTCAAGCTTTGGGCGTGGCTTCCACTGCACAAGGACAGGATGCCGGTTCTCGATGAATTGATAGCGGGCGTGACCCCAACAGCTGGACGTTAGCATCGAAAATGAGTT
TTTAATATTTGACAGTTTCACTGGGGGGAGGTATTTCCCTTGGGCAGTGTTGGCATCCATCTTTTTTTTGGGACGTTTAATTTGGCAGCACGGATTAAATGGTAAATTTTTAGGATTTGG
ATTTTTACAGCACCCCCCCCCCCCCCCGCAACTCGCCGAATACCTCACGGCGCTTCGCGCTTGGTGATGTGAGAGCCTGGTCTGGTGAGAACCCGGCGTGCTCCGTCCCGGCTTTGTAGG
GATGCGAGGTCAATGGTCTAACGACTACGGCATGCACGATTATGAGTACCCCCCCCAATACACATAACAATAACAAACCACACACGCACATGATTTTTTTTGTGGCGTGTATGGCTGGCG
TGCGACAACAGATATGCCCCCGGAAGACAAGGAGAAGACGGCAATGAAGGTGATCGTGACGGGCGAGAGCGAGAAGGTGGTAGGCATCCACATCATCGGCATGGGAGCCGACGAGATGAT
GCAAGGCTTCGGCGTGGCCATGAAG
GTCAGTTCAGGAGTTCACTACACAGCCAGAGGGTTGAAAGCGTTTTCGTTTTCTAACATGTATCGCACGGTACTGCAGTGCCAATTGCCCCATCA
TTTTTTGTTATTTTCGAGATGCATCAGTGCTGTATTGCGTACGATAGAACAATCCCTGGTATGTTTTGCCTGTTTTTTTTTGTCAAAATGACTAAAGACTAGATGAGAACACGAGCTGTT
TCATGCAGCGTTATCGCAACACCCCCAGCCACTCGCCCGTTCGCCCTTACCTTCTCACCAGGCGTCCATGCGTCGTGCTTTTTTCCTTCCTCTCGACGACGCCATTATCTCTCTTATGAA
CTCAGTAACAAGCAACCCTCGTCTCAGCAAATGCGATAGCAGAATGTTGCGTTTTGATGCAACATGTGATTGCTGATTCGCTTATTTTTCGTAGCAGGTAGGCGCGCGTTTGACGCAGCG
GATGATTTTTTCAAGCTTGAGGTTAGACGGATTCGGAAGTCTCTTACAATAGCAAAGATGTTTACAGACTGGAATGATGAACTTGTCACCCCCGCTACAAGTCCATCGATATGAAATAAT
CGAACAAACCTGAAAATAAGTGACCCCTCACATACCCCGGCTTAACCCTCTCTGCGCGCCGCAACGATCAGATATGGGTTGCACGAAGGCTGACTTGGATTCCTGCGTGGCGATCCACCC
CACGGCCTCGGAAGAGCTAGTCACCCTCGCCCCTTGGGGGCTCGAAAACGGGAAGCGAAGCGGGGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCCGAAGCAACCGGTGAAACGCCCCTCGGGGGGCCCGGGGGACACTACGACTACCTCGTCATCGGCGGGGGCAGCGGAGGCGTTTCCAGCGCCCGCCGGGCCGCGTCCCAC
GGGGCCAAGGTCGCCTTGATCGAAGGCACCCCGAACCTG
GGAGGGACTTGCGTTAACGTGGGCTGCGTGCCGAAGAAGGTCATGTTCAACGCCGCCCACATTAACGAGATGCTGCACGCT
TCCAAGCACTACGGATACACGGTGGGCGAGACGTCGTTCGATTGGGGAAAGCTCAAGGAGATGCGGGACGCGTACGTCAGGCGGCTGAACGGCATCTACCACCGCAACGTGGAGAAATCG
GGCGTCACGCTTGTCTACGGG
ATGGCCAAGTTCGTGGGGCCGAAGAAGGCTGTTGTCGAGGGCGTGGAGTATACTGCGGACCACGTCATGATCGCCGTGGGGGGGACGCCGTCGATGCCA
GACGTGCCCGGAGCGGAGCTCTGCATCAACAG
CGATGGGTTCTTCGACGTCACGGAGCAGCCCAAGAAGGTGGCGGTCGTGGGCGCCGGTTACATCGCCGTGGAGCTCGCGGGTATCTTC
GACGCCCTCGGCACGGAGACGCACCTATTCATCCGGCACGAGCGTGCCATGCGAACGCTGGACCCCCTCCTCAGCGACATACTCGACCTCGAG
ATGGCACGCGCGGGTCTGGCCGTGCAC
AAGAACTCGACGACGGAAAAGATCACCAAGGACGAAGCGACGGGAAAGCTCACCCTGCACACCAAGGACGGGCATGCGCTCGGCGACTTGGATGTCGTCCTGATGGCCATCG
GGAGGTCG
CCGAACGTGGGGTCGCTGGGTCTCCCGTCAGCCGGCGTCGAGCAGTCTGAGAGGGGACACATCACCGTGGATGAATGGCAG
AATACTAGCGCCGAGGGGGTGTACGCGCTGGGCGACGTG
ACCGGCAGGGTGGAGCTTACGCCGATGGCCATCGCCGCCGGTCGGACGCTCTCGGACAGGCTCTTCGCGGGTATGAAGGACGCCAAA
GCGGACTACACCAACGTGCCCACGGTGGTGTTC
TCTCACCCTCCCATGGCGACGTGCGGATTGACCGAGCCGGACGCCAGAGCGGCGTACGGGGAGGATGCCGTCAAGGTTTACCAGAGCAAGTTCACCAACCTCTTCTTCGGCCACTGGCAG
ATGCCCCCGGAAGACAAGGAGAAGACGGCAATGAAGGTGATCGTGACGGGCGAGAGCGAGAAGGTGGTAGGCATCCACATCATCGGCATGGGAGCCGACGAGATGATGCAAGGCTTCGGC
GTGGCCATGAAG
ATGGGTTGCACGAAGGCTGACTTGGATTCCTGCGTGGCGATCCACCCCACGGCCTCGGAAGAGCTAGTCACCCTCGCCCCTTGGGGGCTCGAAAACGGGAAGCGAAGC
GGGGTGTAA

Retrieve as FASTA