Entry information : EsilPxd05 (Esi_0000_0287)
Entry ID 16974
Creation 2021-02-04 (Christophe Dunand)
Last sequence changes 2021-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilPxd05 (Esi_0000_0287)
Name (synonym) EsilPxd05 (Esi_0000_0287)
Class Peroxidasin    [Orthogroup: Pxd001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilPxd05
start..stop
S start..stop
EsilPxd02 512 2.04e-164 91..763 14..678
EsilPxd03 489 1.18e-155 87..763 10..679
EsilPxd06 362 1.41e-115 45..501 115..610
EsilPxd04 313 2.73e-92 311..763 209..646
EsilPxd04 136 4.4e-33 94..227 1..135
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16974' 'join(1..151,1969..2015,2512..2585,2937..3339,3681..3800,3870..4000,4586..4733,5366..5561,7026..7225,7928..8148,8960..9056,9720..9826,10647..10797,11507..11752)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..151 149 N° 2 1969..2015 45 N° 3 2512..2585 72 N° 4 2937..3339 401
N° 5 3681..3800 118 N° 6 3870..4000 129 N° 7 4586..4733 146 N° 8 5366..5561 194
N° 9 7026..7225 198 N° 10 7928..8148 219 N° 11 8960..9056 95 N° 12 9720..9826 105
N° 13 10647..10797 149 N° 14 11507..11752 244  
join(1..151,1969..2015,2512..2585,2937..3339,3681..3800,3870..4000,4586..4733,53 66..5561,7026..7225,7928..8148,8960..9056,9720..9826,10647..10797,11507..11752)


exon

Literature and cross-references EsilPxd05 (Esi_0000_0287)
Protein ref. GenBank:   CBN76582.1
DNA ref. GenBank:   FN647682 (1564066..1575817)
Protein sequence: EsilPxd05 (Esi_0000_0287)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   763 (745)
PWM (Da):   %s   82442.48 (80584.4)  
PI (pH):   %s   3.99 (3.97) Peptide Signal:   %s   cut: 19 range:19-763
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLLPLLLVPLLLGACAADGSSVSTAADPTEEAEWDTLVGENERR
TYNGT
GNNLDQPEWGSVGQRLRSMTEASYGDGVSEPPGDDRPTAREVLSEVFLANPSTTSTANALFVGWGLLVGYDLFLTQDNASEPLDIACNDAEIRDVWCPLGSLSDPIPFSRSEAGEDAGGE
EARSPINYATAFVDLDWMYGRDEATSASLRTEDGGYMNMTNDELPHLLDDGTW
VADQRPARLPVTFALMTLLLREHNRCCDEMAPEWDPANDEAFDEMKRCVTVRSKCEWALLLLCCYGK
RAHGGQRSNMEKEKPL
WYLTQSNGSYDAGTDAGTDVFFATVAAPALYSALPSTVGLLDDGFEVMAHEVELATANADLAGLVTRIGGIEPIIRGASYARARGIDASFVAEVSVSSPLFNFP
VEAIQRGRDH
GVPSYNSAREAYALSRFDSFAEITSDTTVQATLSTAYGNDVDLLDAYTGALAETEEGSGLFAGPLLMVFLEQLYRAIVGDRHHHSHSTQNEDAALSTLKNLILNNSLVSS
IPLDSFSAPDLVTSSNCSSTEMNEVTLAE
GYKLAWNQSDLVEEGGDMFITLSARGIEGQGMAIGFGGLSMETADDFVICVVESETSAECTDRSAPRERSEPPLDDEENTDLDVVTVSVDG
EWTSVTFARSGEGTDDSVRDGRGKAK
DYLLSDDIYLSQDTSIIYSWRSGDGIGKHPNSQRGAAQVNFQDGSVADEQCSDSAEYYSLHGALLLVAWMIIAPYGIYQAR*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCCTGCCGCTGCTGCTGGTGCCCCTGCTGCTGGGTGCATGTGCAGCAGACGGGTCTTCGGTCTCTACCGCCGCCGACCCTACAGAAGAGGCCGAATGGGACACGCTCGTAGGG
GAAAATGAACGGCGGACCTACAACGGGACAG
AGGTGAGTCCAGCCTTCAGCTTTGGCAGTGCAGCAGGGAGACGAGCACACCACGTGTTGACGTGGAGTGTGTGTGTCTCGGGTAGATGT
CGCTTTCTGTTACCAGGTGCGCTGTGTTGAGTGTGGTTCGATCTTTGCCGACGGGTTATCATGTGTTGTGCGAGCAAGTAAGTTTCCGACCTTGTACGGGAGAAGAGGAAAGGCAATAGG
ACAAGTTTATGGTGCGGGTGGTGCACGAACATGGTGTGTACCGAACGAGGCTACTACGCGTGTTGTTGGTCGATAGTCCCGCCAATAGACTATACGGCTGAAGACAGATTGCGTTTCTAC
TACTGCTGTGTAGTCTACCGTACGTACGTACGTGTGTCGTCTGGACAAGAGGGTCTATTCAATGACCTGGCGATCATGCAAAAAAAAGAAAGTTCCCGACGTACGATGAGAAAATGAAAT
GCGTTGACCGAGCGAGAGATGGCCGGAGATAGGTGGGTTTGTTTTAGGAAAACTACACACACAGAAAGACTGGTTTGCATCTTGTCTTGGACCGAAACAAAAAACCCGGGGTGTGCCAGG
CTAATGCTGTATAAGGGTCCAGAACCGAGGAGATAGGTTCTTAGTATCAGAGGTGTGGTGTACACAAGTTGTACACAAAAATCCCGGCCAATTCTCTTTTTCAGCGCTTTACTCACACCA
CACACAGGATACGCGAAGAAATAAATGGCGATACAAATAGCGATAAATGGCGATACAAATAGCAGCTGATATGAAGTTCTTCAACTAACTGCTGAGCTGCTCTGCCGCTGGCTCTCCGCT
TCACACACCACACACACTACCTACATGGCGATATATTGTGCTTCAGCGCTGCACTGCTGTCCTCTGCTCGCTCTCCGAGAGCACAAAGGCTACAAAAGCCGCACCACCCCCGATGCAAAA
GAAAAGCGGACGCAAAAGAAGAGAATCTTGAATTGCTCCGGCGATGGAGATTCTTCGCGTCGGAATAAACAGGGAACGATTTGCACGTTTGAGGTTATTTTCTCAATAATGCCCTATTCC
ATAGAAATACGGCATCGATCAACAGCATATTTGCAACACCCTCGGCGGCGTACAACATGAAGAAGGCGTGGTTAAAATTCGAAATTGTCGTATAGGTCGTAGGATTAGTGTCTTCCCCCC
GGTAGGGGCATGACAACAGCACAGCCCACTTTCCAGCTTGCCAGGTCTCGGACCCGTGCAACAGGCACGGTGAAGTGTCGTGTGCGGTACGGCAAAAAAACGGCAAGCAAGAAAGTGTGT
CAATAACATCCGCAGGATGTATGCTACGAAGTAGGAATTGTCAAACCTAATTGGATCTCTCAGTTGTATATCAATTTCTGTGGCAGCGTTTTCCCCGATGTTGGAGGTGTAGTGTGTAAA
ACCCCAGGGGCAACGGGCACGTACACCCAAGTATCACACGGTCCGGGACCCAAGAAGAAGGTTTTTATGTTGAGGTTGGCGGACCTCGAGGAGACAGCGGTCAAAGACCCACATGAGATA
CCACGTTGAGCTCACGTCGCGTGAGCCATTTCCCCAATTCGAATCTCCCGCACGAAGGGCTCCGTCACATTTTCCAACAGCAAAATGCACTGCCTTTGTGCCTCAGGTTCTGCTTACGCT
TGGGCACCCAGTACCGTAGATCCGATGATCGAGCGTCGGGCCTCAAATATGTGGATTTGGTTCCCTCGTTTTTCCGTACCTCCTTTTGTCCGCACATCCGACTTTCTTTCCCTCGAAAAG
AAACGTCACAACTTCGCCCACCTCCAATGCTCCCCTTGCTGTTGACGCAGGAAACAACCTTGACCAACCTGAATGGGGCAGCGTCGGGCAGAGACAGAGGTAAGCGAATAGGTGGACATG
ACACCAGCTGCTGTTATTTTGCTGACTACGGTGCATTCGGTATTGCACAAGGTGGACGGGCCTATCAGGTCGAAAGATGAAGTGCTTTCACTCATTTGATCCTGTATGATCTAGACACTC
GCAAGAGCGCTGAACAATGCACTCGCTTGTGCTATATAAAGTACACGACTGGCGGTGTTCTTTCTGCTGTGTACAAAAAAAATCGTTCTGAGTTGTCGGCCGCATCCCCAACAGGGCTAC
CATAGAATACTTGCATTGGCTTTTTTGGTTCCATGAGTGTGGGTGTGGTGTTGGTCTCAGCTTTTGCACAGTATCTCTTTTTCTGCTCGCTATCACGCCATCTTTCGTGAGCATATAGCA
CCGTCACACTGCAGGAGCCGTGCCTACGCACGAGCCCTTCTCACCATGCTGAGGCAAATTCCCTCCCCTCCTCTATCCCTCTCTTCGTGGACCGCCTACACTGCTTCTCCACCAGCTCCG
CAGCATGACGGAGGCTAGCTACGGTGACGGGGTTTCAGAACCACCAGGGGACGATCGCCCAACTGCGAG
AGGTGACCACAGGGGCTTTGGGTGGCGACCGCCCCCTCCCCCCCTCCCTTG
CTCTCTCTTCTCCGTGTTTGGAGCCGCATAGCAACGGCTTTGCCGGGTAATGGTTCCTGGACGCTGTGCGCGCTGATTCAGCAGTAGGTGCTTTGGTAGTACTTCTCTCGATCCGCCTCC
CGTCGCTCGACTCACAGCGGCCGTCGGTGTCGTGTTTCTTCCGATGTTTTTCGGCCACACGCTGCCGTAGGAACAACTAACCAGCCCCCGCTCCCCCTCCCGTCCCTCGCTCGCGTCCAA
CGCACATGAACTGCTTGACACCATCGCCACGGCCCCTACGGGCCGGCCGTTGCACCGCGTAGAGAGGTCCTGTCGGAGGTGTTTCTCGCCAACCCGTCGACAACCTCGACGGCCAACGCT
TTGTTCGTCGGGTGGGGTTTGCTGGTCGGGTACGACCTCTTCCTCACGCAGGACAACGCGTCCGAGCCGCTGGACATCGCGTGTAACGACGCCGAGATCAGGGACGTCTGGTGCCCCCTG
GGTTCGCTTTCGGACCCGATCCCGTTCAGCAGGTCGGAGGCCGGGGAAGACGCCGGGGGCGAAGAGGCCAGGAGCCCGATCAACTACGCGACGGCCTTCGTAGACCTGGACTGGATGTAC
GGGAGGGACGAGGCGACCTCGGCGTCGTTGCGAACGGAAGACGGGGGTTACATGAACATGACGAACGACGAGCTGCCGCACCTCCTGGATGACGGCACCTGGCTC
TCGTGAGTGATCCGA
CAGCCTATGCCAACTACAAGAGCGATGGTCAAGATCTACGATAGCGAGTTTAGGGAATGGGTCCCCGCATACGGAGCAAGGCGGGGGTCGGGGATCACCGTGCAGTATCCTTGTTACGAA
GGAGTTGGTGTATCGTTCAGGTGGCACCTTCGACGAGCGCTTGCTATGCTACGTAGGAGCCGTTTCACGTGCCGATTTTCGGAATATAACATGTGTGTAAATAGTTGTTGAGACTTTTCT
TTGTTTATATTTTTTTCTTGTTGTTGGCGACGCCCCTCGTCTTTTTTGGGTCTCGACCGCTGCTCCTTGCGCCGTCGACGTGTGGCAGGTGGCAGATCAACGGCCGGCGAGGCTGCCCGT
GACTTTCGCGCTCATGACCCTGCTTTTGAGGGAGCACAACCGGTGCTGCGACGAGATGGCGCCGGAATGGGACCCGGCGAACGATGAG
AGGTCCGGTCATGTCATGAAGAACTGCCGTCG
TTTGGTGAACGCGCTAATTTGTGGTTGCCTATGTAGTAGGCGTTCGACGAGATGAAGCGGTGTGTCACTGTTCGCAGCAAGTGCGAATGGGCTCTGCTTCTGCTCTGTTGCTACGGAAAG
AGAGCACATGGTGGACAAAGGTCGAACATGGAAAAAGAAAAACCGCTTTG
TGGCAAGTATGGTAGTGGTCATCTTGTCCTACTATTGTACCATTTCTTGCTGCAGCAGACACCTTCAATT
CCACAACTTACTCTGTGGTGGATGTGCCTGGCGACGTGCTTGCACGAATGTGCAACAAGCGAAAGGCCACCGGCTTCAGGCTGTATTGTCCCCTCTGACAGCCGTCCTCCCTAACCCCGT
ACACAAACCACTCCCTCGAGGACAGGATACATTCCAGTTCTGTCGGCAGTGGACCATCGCGGTGTTCCAGCACATCACGGAGAACGACTGGTCCGTCCGATTTGTGGGCGGTAGTATTAA
GGTCCTCGGCGCCGCTGCCTACGACGACGATGACCACGACGACCATGGCGAGGAGACGGACGGCAAAAGGCGGCGACGGCGGTTAGGCGACCTCGAGAACGTCGTCCGATCCCGGTACTG
AAGTCTCGCTTTTTTTTTTTACACCTACTGCGCTCCCAGACGCCTTCGCAACCGGAAAACGTGTCCAACCCCGCTATCGGCGACATGCTTTTTTGTTCTCGTGGTTTGGGAAGCCAACCC
CCCTTGTGCCGCTCTTGTCGTGGCTGATTCGCCGCAGGTACCTCACGCAGTCGAACGGCAGCTACGACGCCGGGACAGACGCCGGGACGGACGTCTTTTTCGCCACCGTCGCGGCGCCGG
CGTTGTACTCTGCCCTCCCGTCGACGGTAGGGCTCCTGGACGACGGCTTCGAAGTCATGGCTGAG
AGGTGCGTCCGTGCTTTCACAGCTACTGTCTTGAGGCCGTACATACCACAAACAC
ACCGTTTCATCCTCACAGCAGTAGACGGTCATAGATCTCGATCGGTTTTGTTCTGCCCATCAAACGAAGCAAGCATGGAGAGGCAGATTACTACAGCCGAACAAGGTTGCCATGCATTAC
ATTTGGCTGCTGAAGCCGCTGCGATGGCTGGGGGTACCGAGGTCCTTGATTTTCCGTTGAGGGTAGTAAGCGAAACGAACGTGCGCGCCTTTTGGCTTGAAAACCCGTGGCGAAAGGAAA
CGTGCACTGGAAAAAAGGGATGCGTTTAGATCTGGAACGTTGTGCTCGGCCTTCAAATGTCGTGCGTACTCGATCTACGATTCGCTGAACAGAGTTGCGATGGTTGATTGAGAGAGAGAC
GATGCAAGGACGATTTGTCGTGGAAACTACGACGTGGGCGTACAATGGGGATACTGGTTCATTGATACGCGATGCCATTCCCACCCCCTCCCCCGAGCCGCCTGTGACCCCCACGCTCAC
ACCTCGTTCTTGACCGTCTCCCACCCCACGACTACAAACGTCCGGCGCGAACCTTGCAATGCCATTCCCGCGTACATATCTTCTACGGTAACTTACCAGCACGAGGTGGAGCTAGCCACG
GCGAACGCGGATCTTGCCGGGCTTGTGACACGGATCGGCGGAATCGAGCCCATCATCAGGGGAGCCTCCTACGCGCGCGCTCGGGGTATAGACGCCTCGTTTGTCGCCGAGGTTTCGGTG
TCGTCGCCTCTGTTCAACTTTCCCGTCGAGGCGATCCAGAGGGGGCGCGATCATG
TGGTGAGCGTGAGGAGGCGGGGGCGGGGGGGGGGGGGGGCAAAAAAATTTTCCCTCTTATTTCAA
GGGGGCTCAACCCCTCCCCCTTGAAAGGGGGGGGGGGGGGTCCCCATATCTTGCCTACCCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGGGGGGGTACTCATAGTCGTGCATGCCGTAGTCGTTTGACCATTGACCTCGCATCCCTACAAAGCCGG
GACGGAGCACGCCGGGTTCTCACCGGACCAGGCTCTCACATCACCAAGCGCGAAGCGCCGTGAGGTATTTGGCGAGTCGCATGAAGGGTGAGCTGCATCCTGCTAAAGGCGTTCGGCATC
TTGTGCTTACTTCCTTGCGTACGGATGACAGCTACGTATGACTTAATTTATTTTCTGGTGCTTTCACTTCCAGAGACAGTTGTACGCACTGTGTAACTGCCTCGAGGATGCTTGACCATT
TGAACACAACGTGGTGCGATCATCCCCCGTTGTGCGGAGTGAGGTTTCTCGACCCCGCACAACATGATCTACTCGACCACCATTATGGTTACCGCCAAAAAAAAAACAGTGGTAAAAAAA
ACAAACGGTAACCTGGTTGCCGAGTTCACGAAGTGAATTGGCTTGTTTTACAACGTCGTTGCCAAGCGACGAAAACCCAATCCCGATGGCAAACACCGAGGGGAGGGGGGGGGGGGGGCT
GCGCTTAAGCCCGCACATGAGCATGAGGGTACTGCTGTAGCAGTAGACGATGCCGAGTGGTTAAAGTAGAGGCGATGAAGACGGGTGTCGAACGTATTGATATTGCTGAACAGAAGTGGT
TGATACTGTTGCTGTCGTTTTGCATTTTTAACCGTTCCGATCTGCGCTCGTTAGAATATATGGTACACCACCGCGCTACCCTGTAAACAGACTTTACTCCGTTTGGCCTGTGCCTGCTCT
AGCCCAATGACATCAGAACCCCCTCTCTTCTATGACTGCGGCTAAAAGCGAAGGCGATGGCGATTCTAACGCGTCATTTGTTTCTTGGAAGAGAGTGTGTGAGGACCGCGATACTCGCCT
TAAACGGGGTGGGAGCATCATGTTATATCGACGGCTTTGGATCGTACAAACCCGAGTCAACGCGGTCATGGCGTGGGGGGACAGTTTTCCCCAACGTTAGATAAGGTCCGAGGGGTGATG
TACAACATTTCCCCATCGATGCAATCCACAGGCAGCCGAACAGCTCTCCTGCGCACGCTGCTGTATCTCAACCTCTCTTCGACAGCGTCATTTGGTTTGTGCCCCTTGGCTCCGATGCCG
CCCCGCCCCGTCCCCGCCCTCCTTGGCACCCCTCCTCCACGTCAAACTCCCCGTTCTACCTCTCGCATTCGCCCCGTTAAGGCGTCCCGTCGTACAACAGCGCCCGAGAAGCGTACGCGT
TGTCACGGTTCGACAGCTTCGCCGAGATCACGTCGGACACGACGGTGCAGGCGACGCTCAGCACGGCCTACGGCAACGACGTTGACCTGCTGGACGCCTACACGGGGGCGCTGGCGGAGA
CGGAAGAAGGGAGCGGCCTGTTCGCGGGGCCCCTGCTGCGG
GGGTAAGAGCAAGAGGGGGTCGTGACATGAATGCTAGGAGGAAACCGAGCAGGAGGAGTCTTAATTGATCGTCGCTTGC
TTGCAAGGAGAAGGGGTACAGCGTCCCGTATCGGTTGTGTCCCGCGTATTGTGTCAACGCGAATCGCGCGGTATTACGTTCGAGAGTTGAGAGTTTGGTACCACAGTTTTGTGAGGGGAC
TCCTTGCTGTCCTGTCTCTTGAAAATATCACCCCTTTTGACACGGTCAAAGAACCTCGGGCATCACCTGCAAATGGCTTGTCGTTTCGGGTGCTGTTTGGTAGTTCAGCATCCGTGCCGC
CGATGGCGTAGCTCGTTGGAGATTCCCTTGGCTTTATCGGAAACAAACGATGGCTATCCAGTCAAGTGTGTAACATACTCTCATTCTTGTATTGTGCACCCTCGGTGACATTTCGCGCGC
GAGAGAGAGAGAGGGGAGGGGGGGAGGCTGTGTTTAGCGAATGGGCGTGTCCTGTTTCGACTAGTAGCGTTCGTGCGGCACGAAGGCCGGCAAGTTGTACCCACATGCATGCGCTCGTCG
AGTCCCACGTAAGCTGCTCGTGTTTCCTACGGCCAACGGAGTTCCCACCTCGTTGCCCTCTTTCTTCGTTCTTCTGATCCCAGCTTCATTTCCTCCTCGCTCACCGTACCTCCCCACCCC
ACCCCTCCCTCTCGCGTGTATGTAGATGGTGTTTCTGGAGCAACTTTACAGAGCCATCGTGGGAGACCGACATCACCACTCCCACTCCACCCAGAACGAGGACGCCGCGCTGTCGACTCT
GAAGAACCTCATCCTCAACAACTCACTGGTGTCATCCATTCCGCTCGACTCCTTCTCGGCCCCCGATTTGGTGACGTCTTCCAACTGCTCCTCCACCGAGATGAACGAAGTGACGCTCGC
AGAAGG
GGGTTAGTGCTCGAGGGGGGGGGGGGGGGGGGGGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGTTGGGGGGGGGGGGGCGGGTCGACAAGTTGGGTGACGGGTGCTGG
TTCAACCCCTAACTAAATCTACAGAGCAAGGGAACCCAGTAGCCCTCCCTCTCTCCTCCGTCTCGGAAGAGATGCATGCCCAGTCAACGGTCTCAGCGCAAGGGCAAATAACAACGCGTA
GCACCCCTTGTGTCTGCGGCGAGCGTTCTTCAATCTTTGCCCTTCTCCTCTCGTCTCGCTGTGCGTGTGTCTATCCGCCATGGAACCCATTCAACAAAGTTACAAGCTGGCCTGGAATCA
GTCGGACTTGGTCGAAGAAGGCGGGGACATGTTCATCACCCTCTCGGCGAGGGGTATCGAGGGGCAGGGCATGATC
TCGTGAGTGCTCATGAAGTTGTCAGTGCCGTGCTGCAGTCAAGG
GGGCGCATGTGCGGCAGCGTTGTGCACGGGTGTTGACGTGGTTCTTGGGGGTAACGCATGTAACATTTAGTATTGCTTGGGTGGGGGACGGGTGGTTCGGGGGCACTTCGCAGTTAATGT
AGGGTACAGCGCGTTTGTACGATTCCCGGTGTCTCGTTCCAAGCACGGTTGTCGGTTGTAGGATAGATAGCGTTGTTAAGATACAAGAGCGTATTTCTACGCGCCAAACACGCCTTCCAT
CTCAAGTTTATCCCTCGCGTTGGATCGTACGGATTCTAGAAACGAAGCTGTTCCAACGACAAGTGACTCGCTCGCTCGCTCACTCGCTGGAACCGTTGTGAATAGTGCGATTTTTTCTTG
TGTGTATGTTTTTCGTCGTAGCAGCGTTCCTGTTTGGCGAGAATTCGTGGGCGGGTCTCTCTGGAGATTGTGCATGGTGTTTAGGATATTTTTGTACTGCATACCCCTCGTGCGTGTCTC
GCTCTAACCGTTATGGCCCTAGTTGTGTTGCCTTTTGTTTGTGTTTCTTGTTTTGTTGGCGTAGTTTTTTCTGCTGCCATTCGTACGTGTCCACGAGCCGCCCGCCTTGATGCCGTGTCA
ATTGTTCTCGGTGCGTCAAAGGCAATCGGGTTCGGAGGGCTGAGCATGGAGACCGCAGACGACTTCGTCATCTGCGTGGTCGAGTCGGAGACCTCGGCCGAGTGCACAGACCGCAGCGCG
CCCAGGGA
GAGTGAGTGCAGACAGACAGACAGACACACAAGACAGACAGACAGACAGACAGACAGACAGACAGACACAGACTGACACAGACACTCAGATAGACAAGGAGGAGACAAACAG
ATGGACTGGGAGGCATAGAGACGGGACGGACAGGCAGGGGAGAGAGTGAGAGAGAGCGAGTCCCGGACACGACCTTTTGTGGAAGAGTCCTGCGGGTAGAGTCAACACCATCTGGGTGGT
GGGTGACGCGAGCTCGAAATCGTGGTATAGACATTCGTTGCCGGGGCGCCTGAGAGCATCCAGCTTTGACTACTGAGTATTGGTTCGTCACGCAACAGGGAAGCCGTGAAATGTCAAGAG
ACCGGCACAAAATAAACAGCGGCGGATAACACACGGGCGTTGAGTCAATCAAGGGGCCGTTTGAGTGTTCCCGAATGGCAGATAAGCATGTCCGTGAGGAGGCAACCGAGCGAACCGGCC
TCCTGGGGAGCGAGCACGTCCCGCGATTTCGCCGACTGGTTCGGCTTGCGGAGTATGCGAAAAGTTGTCCCTCATTTTCCGGTCGGTGTCGCGCATTTTGCGGCTTGAGCATCGTTGGGA
CCGCCCTCGCTTTTTCATAACCGGATCGTACAGTATGTTTTAGGAACGTCTCATTGTGTCATCGACCGCGCTTTCGCGCCACAGTGACAAGCCCGTCAGTCTCCGCGGAACCTAGAATAG
GAAGAAAACATTTTTTTTTTTGCCGTTTTATCTTGTAGCTCGTGTCGATCGTGCTGATCGCGACCGCCCAACGTGTCTGTCGGGGGGGGCGTCTTGCGAATTTTTTGCAGGCGGTCCGAA
CCGCCCCTCGATGACGAAGAGAACACCGACCTCGATGTGGTAACCGTGAGCGTAGACGGGGAGTGGACCAGTGTCACCTTCGCGCGCTCCGGCGAGGGCACCGACGACTCGGTAAGGGAC
GGACGGGGGAAAGCGAAAGAG
AGGTCAGCATCAACATGTGTCTTGTTGTTGTTGCTCGGATGTGTGAGGGTAAACTTCCTATCGCCGAGAAACATCACCCCTCTGTGTATATTGAAAGCA
AGAGGTGTAGTTTTGAGTGGACGCCGTCAAATTGAAGTTTTTATGTAGGATTTCGCAAGATTTTGCCCGCTTCCCCACTCCTGAAATCATCTCAGGTGGTATTTTGAATCTGAAACTCAA
CACTCACTGGGTGTGCGGGCGGAAGTACATACTCAGGCTTTGTCGAGGCCGAACGTGTAGGCATGTTTTTCGTGCAGTCAGACAGATTCCAGAGATCTTGTCGAGTTTCAGTGAACGAAT
GCGCACCGATGTCTTCCACCAAACTTCTGCGTGGCAGCGGGTGAAGCGGGGTGCTGTGTGTTGATGCACGACGACTAAGTGAGAAGCAATCGCACCGCAACAAACCGTGCTCTCAGGAAG
AGATGGCCCTAGTCATGGCAACCGCTGGTCGCGAATTGCAGCGGTAGGTTGAGGAATACATACATAAAATTTAAGAGTGAGAAGTAGGGTTCTCTGTGTAAGCGGCATCATTCCAGCAAT
ACGCGTAGCGACGACTGTTGTTGTTGCGCAACTTTTCTTGCATAAAGGGCAAACGAAAGATGAACGCCAGCCCTCCCAGCGAGTTCCTAGCCCTCCGTGTTTGGTTCCCCCTGCGACAAC
ACAATACATCAGGACTACCTTCTTAGCGACGACATATACCTCTCCCAAGATACCTCCATTATCTACTCCTGGCGCTCCGGCGACGGCATTGGCAAGCACCCCAACAGCCAACGCGGGGCG
GCCCAGGTCAACTTTCAGGATGGCTCGGTCGCTGACGAGCAGTGCTCTGACTCCGCAGAGTACTACTCCCTCCACGGCGCCCTGCTACTTGTCGCGTGGATGATAATCGCGCCCTACGGG
ATCTACCAGGCCCGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCCTGCCGCTGCTGCTGGTGCCCCTGCTGCTGGGTGCATGTGCAGCAGACGGGTCTTCGGTCTCTACCGCCGCCGACCCTACAGAAGAGGCCGAATGGGACACGCTCGTAGGG
GAAAATGAACGGCGGACCTACAACGGGACAG
GAAACAACCTTGACCAACCTGAATGGGGCAGCGTCGGGCAGAGACAGCTCCGCAGCATGACGGAGGCTAGCTACGGTGACGGGGTTTCA
GAACCACCAGGGGACGATCGCCCAACTGCGAG
AGAGGTCCTGTCGGAGGTGTTTCTCGCCAACCCGTCGACAACCTCGACGGCCAACGCTTTGTTCGTCGGGTGGGGTTTGCTGGTCGGG
TACGACCTCTTCCTCACGCAGGACAACGCGTCCGAGCCGCTGGACATCGCGTGTAACGACGCCGAGATCAGGGACGTCTGGTGCCCCCTGGGTTCGCTTTCGGACCCGATCCCGTTCAGC
AGGTCGGAGGCCGGGGAAGACGCCGGGGGCGAAGAGGCCAGGAGCCCGATCAACTACGCGACGGCCTTCGTAGACCTGGACTGGATGTACGGGAGGGACGAGGCGACCTCGGCGTCGTTG
CGAACGGAAGACGGGGGTTACATGAACATGACGAACGACGAGCTGCCGCACCTCCTGGATGACGGCACCTGGCTC
GTGGCAGATCAACGGCCGGCGAGGCTGCCCGTGACTTTCGCGCTC
ATGACCCTGCTTTTGAGGGAGCACAACCGGTGCTGCGACGAGATGGCGCCGGAATGGGACCCGGCGAACGATGAG
GCGTTCGACGAGATGAAGCGGTGTGTCACTGTTCGCAGCAAGTGC
GAATGGGCTCTGCTTCTGCTCTGTTGCTACGGAAAGAGAGCACATGGTGGACAAAGGTCGAACATGGAAAAAGAAAAACCGCTTTG
GTACCTCACGCAGTCGAACGGCAGCTACGACGCC
GGGACAGACGCCGGGACGGACGTCTTTTTCGCCACCGTCGCGGCGCCGGCGTTGTACTCTGCCCTCCCGTCGACGGTAGGGCTCCTGGACGACGGCTTCGAAGTCATGGCTGAG
CACGAG
GTGGAGCTAGCCACGGCGAACGCGGATCTTGCCGGGCTTGTGACACGGATCGGCGGAATCGAGCCCATCATCAGGGGAGCCTCCTACGCGCGCGCTCGGGGTATAGACGCCTCGTTTGTC
GCCGAGGTTTCGGTGTCGTCGCCTCTGTTCAACTTTCCCGTCGAGGCGATCCAGAGGGGGCGCGATCATG
GCGTCCCGTCGTACAACAGCGCCCGAGAAGCGTACGCGTTGTCACGGTTC
GACAGCTTCGCCGAGATCACGTCGGACACGACGGTGCAGGCGACGCTCAGCACGGCCTACGGCAACGACGTTGACCTGCTGGACGCCTACACGGGGGCGCTGGCGGAGACGGAAGAAGGG
AGCGGCCTGTTCGCGGGGCCCCTGCTGCGG
ATGGTGTTTCTGGAGCAACTTTACAGAGCCATCGTGGGAGACCGACATCACCACTCCCACTCCACCCAGAACGAGGACGCCGCGCTGTCG
ACTCTGAAGAACCTCATCCTCAACAACTCACTGGTGTCATCCATTCCGCTCGACTCCTTCTCGGCCCCCGATTTGGTGACGTCTTCCAACTGCTCCTCCACCGAGATGAACGAAGTGACG
CTCGCAGAAGG
TTACAAGCTGGCCTGGAATCAGTCGGACTTGGTCGAAGAAGGCGGGGACATGTTCATCACCCTCTCGGCGAGGGGTATCGAGGGGCAGGGCATGATCGCAATCGGGTTC
GGAGGGCTGAGCATGGAGACCGCAGACGACTTCGTCATCTGCGTGGTCGAGTCGGAGACCTCGGCCGAGTGCACAGACCGCAGCGCGCCCAGGGA
GCGGTCCGAACCGCCCCTCGATGAC
GAAGAGAACACCGACCTCGATGTGGTAACCGTGAGCGTAGACGGGGAGTGGACCAGTGTCACCTTCGCGCGCTCCGGCGAGGGCACCGACGACTCGGTAAGGGACGGACGGGGGAAAGCG
AAAGAG
GACTACCTTCTTAGCGACGACATATACCTCTCCCAAGATACCTCCATTATCTACTCCTGGCGCTCCGGCGACGGCATTGGCAAGCACCCCAACAGCCAACGCGGGGCGGCCCAG
GTCAACTTTCAGGATGGCTCGGTCGCTGACGAGCAGTGCTCTGACTCCGCAGAGTACTACTCCCTCCACGGCGCCCTGCTACTTGTCGCGTGGATGATAATCGCGCCCTACGGGATCTAC
CAGGCCCGGTGA

Retrieve as FASTA