Entry information : MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
Entry ID 17003
Creation 2021-03-30 (Christophe Dunand)
Last sequence changes 2021-03-30 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2021-04-04 (Christophe Dunand)
Peroxidase information: MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
Name MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Marchantiaceae Marchantia
Organism Marchantia polymorpha    [TaxId: 3197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpPrx[P]21
start..stop
S start..stop
MpPrx18 195 1e-62 1..135 224..356
MpPrx19 186 1e-57 1..135 389..521
MpalPrx18 181 2e-57 1..135 198..330
MpPrx22 154 3e-47 1..135 165..297
Literature and cross-references MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
Protein sequence: MpPrx[P]21(Mapoly0245s0004 / Mp2g25010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   135
PWM (Da):   %s   14129.05  
PI (pH):   %s   7.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
IGRKDGVVSI AAESMASLPS PIADYTQLVQ GIAAVCLSEK DMVVLSGHSI GRAKCGAFSH RIYGFSGLGQ SMGQINGTDP TLDPEYAKVL RQQCPQHAHL NTVFLDPSGC FSGQTSKYPS 
EAVKDKRGVL PSDAA 

Retrieve as FASTA  
Remarks ¨seudogene form genomic. exons 1 and 2, and end exon 4 are missing. Incorrect prediction from Phytozome (only part of only exon 4). Not found in the two other Mpol ssp , nor in the Mpal
A second pseudogene can be found downstream with frames shift and stop in frame. QIEGGSWVVDLGRKDGVVSIAAESMASLPSPFADYTQLVEGFAAVGLSEKDMVVLSGxHTVGRAKCGAFSQRLYGFSGPWAINGTDPTLDPEYAKVLK*QCPQNAHLNTVFLDPSGSFPGQTYDKGYFEAVKANKGVLASDAALLTSSFGASLVAVEAS