Entry information : MpPrx[P]34(Mapoly0341s0001 / Mp3g18410)
Entry ID 17004
Creation 2021-03-30 (Christophe Dunand)
Last sequence changes 2021-03-30 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2021-04-04 (Christophe Dunand)
Peroxidase information: MpPrx[P]34(Mapoly0341s0001 / Mp3g18410)
Name MpPrx[P]34(Mapoly0341s0001 / Mp3g18410)
Class Class III peroxidase     [Orthogroup: Prx313]*
Taxonomy Eukaryota Viridiplantae Streptophyta Marchantiaceae Marchantia
Organism Marchantia polymorpha    [TaxId: 3197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpPrx[P]34
start..stop
S start..stop
MpalPrx38 516 0 22..320 23..322
MpPrx35 511 0 1..263 1..263
MpPrx38 508 0 1..320 1..322
MpalPrx05 339 1e-116 26..317 47..339
Literature and cross-references MpPrx[P]34(Mapoly0341s0001 / Mp3g18410)
Protein sequence: MpPrx[P]34(Mapoly0341s0001 / Mp3g18410)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317
PWM (Da):   %s   33512.14  
PI (pH):   %s   7.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MAFSRTMLSS VVLALFSLVA VGQAQLSTTF YSSSCPTALS IVRQQVDSIL ASNPNLAGGL QRLHFHDCFV RGCDASVLLF SASSTNQEKD AQPNQNSLRG FQQIDQVNSA LEAACPGVVS  CADILAIVAR DATVKAGGQT WPVLLGRRDG TVSLASEALA ALPSPLLNLG QLIQNFAAVG LNASDMIVLS GAHTFGRARC GPVLNRLYNF NGVNGQTDPS MDSTLAANLK KQCPPNEVTT 
IITMDSSPNV FDRTY*KQVI TREGLFTSDA ALATDSRALA LATRLAQPGS TFSPILQLPW *R*AEYQVVG SEAEARKLLS 

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome, stop in frame in last exon, exon 3 and part of exon 4 are also repeated downstream (AGGQTWPVLLGRRDGTVSLASEALAALPSPLLNLGQLIQNFAAVGLNASDMIVLSGAHTFGRARCGPVLNRLYNFNGVNGQTDPSMDSTLAANLKKQCPPNEVTTIITMDSSPNVFDRTY*KQVITREGLFTSDAALATDSRALALATRLAQPGSTF)