Entry information : PtaPrx127(PTA00034526/ PTA00034525)
Entry ID 17024
Creation 2021-04-13 (Christophe Dunand)
Last sequence changes 2021-04-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2021-04-26 (Christophe Dunand)
Peroxidase information: PtaPrx127(PTA00034526/ PTA00034525)
Name PtaPrx127(PTA00034526/ PTA00034525)
Class Class III peroxidase    [Orthogroup: Prx162]
Taxonomy Eukaryota Viridiplantae Streptophyta Pinaceae Pinus
Organism Pinus taeda (loblolly pine)    [TaxId: 3352 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtaPrx127
start..stop
S start..stop
PtaPrx35 590 0 1..323 1..323
PtaPrx113 576 0 1..323 1..323
PabPrx187 573 0 1..323 1..324
PabPrx18 565 0 1..323 1..323
Literature and cross-references PtaPrx127(PTA00034526/ PTA00034525)
Protein sequence: PtaPrx127(PTA00034526/ PTA00034525)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323
PWM (Da):   %s   34405.92  
PI (pH):   %s   8.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MAASIKSFAG IAVMVFIMCS ITDTAYGQLS STFYDKSCPK ALSIVQAGVK RAVANEKRMG ASLLRLHFHD CFVNGCDGSV LLDNSTSFTS EKYAIPNNNS ARGFEVIDSI KSQLESACSG  VVSCADILAI AARDSVVELG GPSWTVMLGR RDSTTASLSG ANANIPPPSS NLSNLISLFQ AQGLSTKEMV TLAGGHTIGQ ARCFSFRAHI YNDTNIDSTY ATSLRSKCPS ATGSGDSNLS 
PLDYMTPTVF DNNYYVNLKS KKGLLHSDQE LFNGGSTDSQ VTTYSSNQNT FFSDFAAAIV KMGNIKPLTG TSGEIRKNCR KPN* 

Retrieve as FASTA  
Remarks Incorrect prediction (extra repeated seq). Intron 2 contains a repeated sequence (CDGSVLLDNSTSFTSEKYAIPNNNSARGFEVIDSIKSQLESACSGVVSCADILAIAARDSVVEV)
DNA
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGGCTGCTT CTATTAAAAG CTTCGCAGGC ATTGCTGTAA TGGTGTTTAT TATGTGTTCG ATTACTGATA CTGCGTATGG GCAACTGAGC TCCACGTTTT ATGACAAGTC TTGTCCCAAG  GCCTTGTCAA TAGTGCAAGC CGGGGTGAAG CGGGCTGTTG CAAATGAGAA ACGCATGGGG GCTTCGCTTC TACGCCTTCA CTTCCACGAC TGCTTCGTTA ATGTAACTGC AAGAATTCAT  TTTATTATTA TTGATTGAAC CAGCTTAGCG AAGGCCATTA ATGGCGATAT TTTGATTTGG AGGCAACTCA TCATGCATTC ATTTGTTATT GCAGGGTTGC GATGGGTCCG TTCTGTTGGA  CAATTCCACG AGTTTCACTA GCGAGAAGTA CGCTATTCCC AATAACAATT CCGCCAGGGG TTTCGAGGTG ATCGATAGCA TAAAGAGCCA ACTCGAGAGT GCTTGCAGCG GAGTCGTTTC  CTGTGCAGAC ATTCTCGCCA TTGCTGCTCG TGATTCTGTT GTTGAAGTAA GGCAGTCTCA TTAACCTAAT AGTAGTCTTT AACATAGTAG CTTTTAAGTG TAAGTTTTTG GACTTCTTAA  TGTATTTTCn nnnnnnnnnn nnnnnnnnnA TCATGCATTC ATTTGTTATT GCAGGGTTGC GATGGGTCCG TTCTGTTGGA CAATTCCACG AGTTTCACTA GCGAGAAATA CGCTATTCCC  AATAACAATT CCGCCAGGGG TTTCGAGGTG ATCGATAGCA TAAAGAGCCA ACTCGAGAGT GCTTGCAGCG GAGTCGTTTC CTGTGCAGAC ATTCTCGCCA TTGCTGCTCG TGATTCTGTT  GTTGAAGTAA GGCAGTCTCA TTAACCTAAT AGTAGTCTTT AACATAGTAG CTTTTAAGTG TAAGTTTTTG GACTTCTTAA TGTATTTTCA GTTTGAATTT GGCAAAAAAA TTATGGTTGA  ATTTTGATTT GTTGTTTAAA CTGGTTTTTC TGACTGCATA TATAGATTCA GCACCCCAAT CAAATTTATG ATTTCAATAA ATTCTTCCTA AATTTATTAT AAATTCTTTC TAAATTCTAA  ATAAATTAGA TCCAAAAATA CGTAGAAAAA CTTTCCAAAA ATCACACTAA AAAATACCTA ACTCAGTCAG GTTGTTGCCT TTATCTGAAT CATTTCTCAA AACTGAAATA TTATAATCAT  TGTACTTTTT TGTTTGTCAA GTTCTCTATG TTCCTTCAGG CTTGACATGT GGCTTGAGAA ACTGCCCTAG GAGTTTTTAA GCCATCAAAG TCACCAGAGA TAGTACCCGG CCTGGGTCAC  ACCAGTTCTA AGCTGACTGG GTTTTAGTGT GCAGCTCTAA GTTGACTAAA TTTTAGCGTG TCTCCTCACT GGCCCCTGGG TCACATCAGC TCTAAGCTGA CTGGATTTTA GGTGTCTCCT  CCTCTAGCAC AGGTGCAATA TCCTTAGTGA GATTTAATTG TGGGTGGCTT TGTTAAAGAA GCTCATCCTC AAAGGGTTGT GCTAATAAAA CACTAAGAAA TAATATCATC ATTTTCATAA  TTATTCTATT TTAACAAAAT TTTCATTTAC AGTTGGGTGG GCCTTCGTGG ACGGTGATGT TGGGGAGGCG AGACTCGACA ACAGCAAGCT TGAGTGGTGC AAACGCTAAC ATTCCGCCTC  CGTCTTCGAA TTTAAGCAAC CTAATTTCAC TATTTCAGGC ACAGGGCCTC TCCACAAAGG AAATGGTTAC ACTTGCTGGT AATCATAATA TTGTTTTGAT TTTCTAATAC ATTACAAAGC  ATTAATGAAT ATTATAAAGT CTCCCTTCTG TTAATTCTAC TTTTACAGAT TTAGTAGGAT GTTATGAAAG CAATTGTTCA ATTTTTTATT CTCAATTTTG AACAAGATCT TTTCTAAGAA  GAATTAATCC CTGTGATTAA CATGTTTAAG CATTCTCTAG CTTTCCTGCT GAAAAAAATA AAACAAAAAA ATGGATCATT AAGATAACCT GAAGAATTAG TGGATGAACT ATATGTTGAT  GGATGGTTTT GAATAAATCT GATATGATAT TCAATCTGTA GGTGGTCATA CTATCGGGCA GGCGCGGTGT TTTAGTTTCA GAGCCCATAT TTACAACGAC ACCAATATCG ACAGTACGTA  CGCCACTTCA TTGCGTTCAA AGTGTCCGAG CGCCACAGGC TCCGGGGACA GCAACCTATC GCCATTGGAT TATATGACTC CCACTGTCTT TGACAACAAC TATTACGTCA ATCTGAAAAG  CAAGAAAGGA CTTCTCCACT CCGATCAAGA ACTCTTCAAC GGAGGTTCCA CTGATTCCCA GGTGACCACC TACAGCTCCA ACCAGAACAC CTTCTTCTCG GATTTTGCTG CCGCCATAGT 
TAAGATGGGG AATATCAAAC CTCTTACGGG CACCAGTGGA GAGATCCGTA AGAATTGCAG GAAGCCTAAC TAA 

Retrieve as FASTA  
CDS
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGGCTGCTT CTATTAAAAG CTTCGCAGGC ATTGCTGTAA TGGTGTTTAT TATGTGTTCG ATTACTGATA CTGCGTATGG GCAACTGAGC TCCACGTTTT ATGACAAGTC TTGTCCCAAG  GCCTTGTCAA TAGTGCAAGC CGGGGTGAAG CGGGCTGTTG CAAATGAGAA ACGCATGGGG GCTTCGCTTC TACGCCTTCA CTTCCACGAC TGCTTCGTTA ATGGTTGCGA TGGGTCCGTT  CTGTTGGACA ATTCCACGAG TTTCACTAGC GAGAAATACG CTATTCCCAA TAACAATTCC GCCAGGGGTT TCGAGGTGAT CGATAGCATA AAGAGCCAAC TCGAGAGTGC TTGCAGCGGA  GTCGTTTCCT GTGCAGACAT TCTCGCCATT GCTGCTCGTG ATTCTGTTGT TGAATTGGGT GGGCCTTCGT GGACGGTGAT GTTGGGGAGG CGAGACTCGA CAACAGCAAG CTTGAGTGGT  GCAAACGCTA ACATTCCGCC TCCGTCTTCG AATTTAAGCA ACCTAATTTC ACTATTTCAG GCACAGGGCC TCTCCACAAA GGAAATGGTT ACACTTGCTG GTGGTCATAC TATCGGGCAG  GCGCGGTGTT TTAGTTTCAG AGCCCATATT TACAACGACA CCAATATCGA CAGTACGTAC GCCACTTCAT TGCGTTCAAA GTGTCCGAGC GCCACAGGCT CCGGGGACAG CAACCTATCG  CCATTGGATT ATATGACTCC CACTGTCTTT GACAACAACT ATTACGTCAA TCTGAAAAGC AAGAAAGGAC TTCTCCACTC CGATCAAGAA CTCTTCAACG GAGGTTCCAC TGATTCCCAG  GTGACCACCT ACAGCTCCAA CCAGAACACC TTCTTCTCGG ATTTTGCTGC CGCCATAGTT AAGATGGGGA ATATCAAACC TCTTACGGGC ACCAGTGGAG AGATCCGTAA GAATTGCAGG 
AAGCCTAACT AA 

Retrieve as FASTA