1. Browse the Database
  2. View Redoxidase
Entry information : InPrx[P]140
Entry ID 17611
Creation 2022-04-25 (Christophe Dunand)
Last sequence changes 2022-04-26 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2022-05-04 (Christophe Dunand)
Peroxidase information: InPrx[P]140
Name InPrx[P]140
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Convolvulaceae Ipomoea
Organism Ipomoea nil    [TaxId: 35883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value InPrx[P]140
start..stop		 S start..stop
InPrx35 553 0 1..293 1..290
IaquPrx56 537 0 1..293 1..290
InPrx31 531 0 1..293 1..290
InPrx30 528 0 1..292 1..289
Literature and cross-references InPrx[P]140
Protein ref. GenBank:   XP_019164345.1
Protein sequence: InPrx[P]140
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   293 (271)
PWM (Da):   %s   31643.73 (29220.6)  
PI (pH):   %s   6.35 (6.35) Peptide Signal:   %s   cut: 23 range:23-293
Sequence
Send to BLAST
Send to Peroxiscan
*.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MASSSYFFGT ILLFSFATMS FSDSLSPFYY QRVCPQALPT IQRIVFDAIR QEHRMGASLL RLHFHDSFVN GCDASLLLDS TSTVDSEKNS LANANSARGF EVIDRIKSAV DKVYNGLVVS  CADILAVVAR DSVFALGGPS WTVQLGRRDS TTASKTDxxx ADNNLPSPFM DLTALIDNFS KQGLDVKDLV VLSGGHTLGL AQCRTFRDRI YNDTNIDQGF ATQRQASCPR VGGNSTLAPL 
DPSPAFFDTR YFSNLVMKKG LLHSDQVLFN GGQTDNLVNT YCGNIRVFAN DFA 

Retrieve as FASTA  
Remarks Partial sequence or pseudogene . End of exon 4 is missing and extra sequence in the exon 3 (ATTGNYGISDHRKVILNQVKSKKWSEIATKVVGNSIIFSSG) XP_019164345.1 (exons 3 and 4) and XP_019164369.1 (exons 1 and 2) . Incorrect prediction from NCBI.