Entry ID | 17611 |
---|---|
Creation | 2022-04-25 (Christophe Dunand) |
Last sequence changes | 2022-04-26 (Christophe Dunand) |
Sequence status | theoretical translation / pseudogene |
Reviewer | Not yet reviewed |
Last annotation changes | 2022-05-04 (Christophe Dunand) |
Name | InPrx[P]140 | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Class | Class III peroxidase [Orthogroup: Prx012]* | |||||||||||||||||||||||||
Taxonomy | Eukaryota Viridiplantae Streptophyta Convolvulaceae Ipomoea | |||||||||||||||||||||||||
Organism | Ipomoea nil [TaxId: 35883 ] | |||||||||||||||||||||||||
Cellular localisation | N/D |
|||||||||||||||||||||||||
Tissue type | N/D |
|||||||||||||||||||||||||
Inducer | N/D |
|||||||||||||||||||||||||
Repressor | N/D |
|||||||||||||||||||||||||
Best BLASTp hits |
|
Protein ref. | GenBank: XP_019164345.1 |
---|
Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Sequence 0 Send to BLAST Send to Peroxiscan |
|
||||||||||||
Remarks | Partial sequence or pseudogene . End of exon 4 is missing and extra sequence in the exon 3 (ATTGNYGISDHRKVILNQVKSKKWSEIATKVVGNSIIFSSG) XP_019164345.1 (exons 3 and 4) and XP_019164369.1 (exons 1 and 2) . Incorrect prediction from NCBI. |