Entry information : SpPrx04
Entry ID 1767
Creation 2005-06-29 (Christophe Dunand)
Last sequence changes 2005-06-29 (Christophe Dunand)
Sequence status partial
Reviewer reviewer name not stored
Last annotation changes 2007-09-20 (Christophe Dunand)
Peroxidase information: SpPrx04
Name SpPrx04
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum propinquum    [TaxId: 132711 ]
Cellular localisation N/D
Tissue type Rhizomes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpPrx04
start..stop
S start..stop
SbPrx04 256 5e-87 13..137 27..151
SiPrx146 220 5e-73 13..137 23..142
ZmPrx92 219 3e-72 13..137 28..151
HvPrx93 179 9e-59 28..137 15..124
Literature and cross-references SpPrx04
Literature RDSDPTLDGAYAAELRRTCRSRRDKTTELEMVPGSSTTFDTAYYGLVVKRTALFHSDEALxxxxxxxxxxxxxxRDSDPTLDGA YAAELRRTCR SRRDKTTELE MVPGSSTTFD TAYYGLVVKR TALFHSDEAL LRNQETRALV YRYRDAAAGS EQAFLRDFGV SMVNMGRVGV
LTGDQGEIRK RCAFVN
EST ref. GenBank:   BG605669 [3' end]   BG605991 [Fragment]
Protein sequence: SpPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   137
PWM (Da):   %s   14441.16  
PI (pH):   %s   5.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
TRPAAACDCF VRAAHGYGHG GDDDDGAGKL RVGFYKDSCP DAEAIVRRVV AKAVHEDPTA NAPLLRLHFH DCFVRGCEGS VLINSTKGNK AEKDAKPNLT LDAFDVIDDI KDALEKRCPG 
TVSCADILAI AARDAVS 

Retrieve as FASTA  
Remarks Partial sequence from singleton. No overlap between 5' and 3' end but compiled based on homologies with S.bicolor sequences.