Entry information : ZmPrx14
Entry ID 177
Creation 2007-11-19 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-09 (Qiang Li)
Peroxidase information: ZmPrx14
Name ZmPrx14
Class Class III peroxidase    [Orthogroup: Prx213]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx14
start..stop
S start..stop
ZmPrx62 701 0 1..373 1..373
SbPrx39 325 5e-110 44..371 28..368
SiPrx142 314 3e-106 62..371 15..320
HvPrx64 314 6e-106 35..371 21..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 212997404..212997757 354 N° 2 212990511..212991278 768  
complement(join(212990511..212991278,212997404..212997757))


exon

Literature and cross-references ZmPrx14
Literature Duvick,J.P., Maddox,J.R., Navarro Acevedo,P.A. and Simmons,C.R. Maize peroxidase genes and their use for improving plant disease resistance and stalk strength.
Protein sequence: ZmPrx14
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   40212.98  
PI (pH):   %s   6.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKVAALTITLLGLLVSVTCQGSTYPAQQQQEASSSSSSPGCILRGWIPFLPPCRDDQAPTPNPLPPPSGAGLTVGYYKNCPGAEGIVREAVEKAMDNGNRGIGAGLVRIFFHDCFVRGCDASVLLRNTSGSSNQTEMFGLPNINSLRGFQVIDDAKAELEKACPRTVSCADIVAFAARDATRNLSYGAIDFQMPAGRLDGRVSLKEEAEKNLPGPFDSLDDLQKSFAAQGLGFNDMVTLSGAHSIGVARCRFFTNRLPPNPSDMDRDLARSLKATCDQNGLDSKVVQDPVTPVALDNQYYKNVHNGKVLFTSDAALNSTDDARKVVDGFANNAVDWYRAFADAMVKMGNIRDRTINRPKPEIREKCFIYNTY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1) and 6 ESTs. Same unigene with ZmPrx62, but two independant sequences (confirmed with the intronic sequence).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGGTTGCCGCCCTGACGATCACCTTGCTCGGGCTCCTGGTGTCCGTGACATGCCAGGGCAGCACTTACCCTGCTCAGCAGCAGCAGGAGGCTTCGTCGTCGTCGTCTAGCCCT
GGTTGCATTCTGCGAGGGTGGATCCCGTTCTTGCCTCCTTGCCGCGACGACCAAGCCCCAACGCCAAACCCTCTCCCTCCTCCCTCAGGGGCAGGGCTCACCGTGGGCTACTACAAGAAC
TGCCCTGGCGCTGAAGGTATCGTGAGGGAGGCCGTGGAGAAGGCCATGGACAACGGAAACCGCGGCATTGGCGCAGGACTCGTTCGTATCTTCTTCCACGACTGCTTTGTTCGG
GTACGT
ACGTCATCTCATTTCATCTTATTATATGGGATACACATGCTGCAACTTATTGGTGCTCGATCCCCAGAACACCTGTCCGTGCTTCTAGCTTCGCTGTGGGCGCTGCCTACCCACAAGCGG
GAGAGTTTCTCTGGAGGGTGGCGATCCATCCCTTTCCGCCCGCCAGACTTTGGTCCTCAGCCAGGAGGGGGAGGGGGTGAGCTCGCTGGTGAAACTTCAGAGAAGATGGACCCAAGGCTG
AAACCCTCACAGTGGGATCGGTGGAACTCTAAGGAGGCGAGGAATCCACCCAATGCTTGGGGAAGACACCGCAATATGAGCTGGCGACTCCGACCCTCACACGTGAAATCTGAGGGAGAG
GTGATTGGATCATCATCTGGTGACATGAATAACCCAGGTAACCCTAAATCCCCGACTCTCCCTGGGATGCTGGAGGTAGAAGGAAGTCGTCGCACATTCTGCCAAAAATGCGGTGATGAA
GGTCATCATGCCAGAGATTGTTCTAGGGCTTTGTGGTGTGATATCTGCATGAAAGAGACTCATGTAACTGCGAAATGTGTGTGGCCAAGACAGAACAAACCTATTATGCCATTAGTGGGA
ATGGCAGCAGATGGTTTGAGTTTTTACTCCTCTCAGTTTGGAAAGAACATTTCCAAAAAACCAAAGAGGAGCCTGTTGGGATTAGTCAAAATTGTGGAGGGGATTGTGTCTGCTGGTGAT
CTGGAGAGGGATTTTAGCTTCCATTTCCCATGGGGACGACCCTGGAAAGCTGATAAGTGTCATCTTGGTTTCCTGATGCAATTCCCATCACAGGACAGGCTTGATGAACTGACCAACTTT
ACTGAGTTGAAGATGAAGATTTCAGGGGTTAAGATTGTAGTAACTGTGTGGAACTCTCAGGTTTTGGCTAAATCCAGATTGCACTCAGTTTGGATTAAGGCCGATAATGTGCCTGAAGAA
TTGTTGAACTATCAAGCCATATGTGAGTTGGGTTCGGTTTTAGGAGCTGTGGAAGAAGTGGATCTGGCCGCTCTGAAATCCAATGACATGGTTAGATTTAAAGTGCATGTGAAGAGCATC
GCGAGGATTCCACCTGTCATTGAGATAGGAGTCAAGCATCTCTTATATGACATTTATTTTAAGGTGGAAAAGGTAGAAACTGAAGGATGGAATGAGGAAGAAGCTAGTATGAGAAAGAGA
TCTTCTGTTGATTTACAGCCGAACGAGTTCGGTTTGGGTGACAATGGAGGGAAAAAACCCAAAAGTGATATTCATGAAAGTGGGAAGGTCCCTCTGATTCCTGTAAATCAGAAAACATCT
TCCTCTGAGTTTAAAGAAGCAATGTTTGCTACAGATCCACAAACCAATGAATGTGACAAATGCAATGAAGAGGGGGAAAATCTGGGGGATGAAAACAATGAGAAGGTAGACTTTGAAGAC
AGTGATGAAGACCTTCTTAGTTCCCAAGAGCTTAACAACTTTGTGAAAGGAATGGGTGTTGAGATAGCGGATGAGCAGGAATTGGAGATGGATGAGGGTGAACTCCTCAAAGTTCAAGAT
GAGCAACAAACTGGTAAGGATAAAAAAGGTAAAGCCAAGTTGGTAGATCAAGTTGAAGGCACAAGGAAAAGTAGCAGACTGGAGGCAAATGAAGATATCAGGATTACGGACAAAGCCATC
AACAGAGCTGAAGCGAAGGATGCCTTCTTGAACATAGGTAACAACCCCAACCCTTTCTCTATCTTAAATTCTGAAAACAGCTTGCTGATTGATATAGCTAACAAACTTGGGGTGAATCTG
GGAAAAGATGATAATGAAAGATTAGATAACTTAGAAATGATCAAGTGCTTAGAAGAAGAACGTGCCAGGGCTATTATGCCAGACGTTGGTGCTGATGATATTGATAATAAATTCGCTGGT
AATTTAGTGGAGAATGAGGATCCTTCGATTATGGATAGAATTGTCCAAGAGATGATAGAGAGTGAATCGGAAGGGAAAAAGAACAAAACACCAAAGAAGAAGAAAAAAATACAGAAAGAG
AAAAAATATTCTCTGAGGAAAAAAAAGGGTTCTCCAAAAATTAGATATACATCTAATAATAGGAGATGCCTGAAGCGTCATCAATGGGACAACCAAGTATCTGAATGAAAGGGGTAATAT
GGAACTGCCAGGGGCTTGCCAAACCCGGGAAAATTGAGTTCATTCATGAACTCATAAACAAGGAAAAAGTTGATTTCATTAGTCTGCAAGAGACTAATAAGAAAGAATTTGGGCAGAACT
GGTTACTGTCTTTAAGCAGTAATAAGTTGTTTAAGTGGATTTCTTCTCCGCCTAATGGTAGATCAGGGGGTTTGCTGGTGGGTTTTAATTCAGACACTTTGGATGTCTCGGACATTCAAA
TCAAGGACTTCATGATTGTGTGTCGGGTGCATCACAAGATTAAAAATCTTTCTTGGACTTTTGCTAATGTCTATGGGGCAGCTCAAGCGGTTAATAAAGATAATTTCTTAAGCGAGTTAG
CTGCCACTTGCTCCCACTGTAGTGGTCCCATTCTGCTAGGTGGTGACTTTAACATTTTGAGGAGTAGTGATGACAAAAATAAGCCTTATGTTGCCAATAGATGGACGCTTCTCTTTAATG
CCATCATTGATCAGCACGGTCTGGTTGAGCTAGATCTAACTGATAGGAAGTTTACGTGGTCCAATAATAGAAATCCTCCCACTTTTGAAAAACTTGACAGATTTCTAGTGAGCCCTGATT
GGGATTTATTATACAGCAATGCTAGGGTTAGAGGGCTGAACAGATTTCTTTCAGACCATGTTCCTTTGATGTTAAGCACTGAGGATTCAAAAAAACCTGTTGCTACTTTTAGATATGAGT
TGCTCTGGCATAAAAAACCTGATTTTAGAGAGTTGGTTTGTAGAAGTTGGGAGCTTCCAATAAGGAGTAAAGGAAGTCTTAACATTTGGAAAGAGAAAGTTAAGAGACTCAAAAAATACC
TTAAGGGTTGGAATTTCAATGAAGAAGGGAGTAACAAGAGAAGGAGAGAAGATCTTTTGAAGAAAATCAATGGGTTAGACATTAAAAATGAAGAAGGGGGGCTGTCGGATAATGAAAAAA
TGGCGAAAAAAGATTGTGAGCTTTTGCTTAATAAACTTCTCTTCGAGGAAGAGATGAAAATGAAGCAGAGAGCTCGTGAGAGGTTAATTACGGAAGGAGATGAAAATACAAATTATTTTC
ATCAAAAAGCCAATCTCAATAGAAGGAGAATCAGGATTCATGCTCTGATGGATAAGGAGAACTTGGTTGAAGAGGAGGATGAGAAGAATCGGATTGCTACTAACTTCTATAAAAACTTGT
TTGGCCCTTCTCCTATCTCTGCCATCTATGTGGAGGATAGAAACATGGATAAGATTAGCGATGAGGACAGATGTATCCTCACTGCCCCTTTTACAGAGACTGAGGTTAAGCATGTAGTAG
ACAACTTTAAACACAATAGTGCCCCAGGCCCTGATGGTCTCCCTGCAGAATTTTTTAAGGACTTCTGGGACATTATTAAAAAGGACATCATGAAGTTGTTTGAAGACTTTTTCAAAGGAA
AACTGGACATTAAAAGATTAAACTATGGTGTTGTCACTTTAATTCCTAAAGTGGACAAGGCTATAGATATGAAAAACTTTAGACCCATTTGTCTTTTAAATGTTTGCTATAAAATGATCA
CCAAAGTCCTTAACAAATAGGTTGTCAAATTGTATCACTAAGGTGATTAGTGATAACCAGTTTGGCTTTATTAAAGGAAGATATATTTTGGATGGTGTTGTGGCCCTTCATGAGATTATT
CATGAAGTAAAAAAGAAAAAGCAAGATGGGATCATTTTGAAAATTGATTTTGAAAAGGCGTATGACAAAGTTAATTGGCATTTCTTATATAAAATGCTTGAGATAAAAGGATTTGGCGAG
AAATGGGGAGACTGGGTGATGAAAACAGTTAGTGGGGGCAAGGTTGCCATTAGGACTAACAATCTAACTGGCCCCTTCTTCTCTACGCATAAGGGGGTAAGACAGGGAGATCCCTTATCT
CCGTTGCTCTTCAACATTGTTGCGGATGGTCTTTCTTGCATGATTAAAAGGGCCCAGGAGGTTGGTCTTTTGGTGGGCCTTGTTCCTCACATCATTGAAAATGGTTGTGCTTGTTTACAA
TATGCAGATGACACTATCTTCCTTCTTCAGGATAACCCGATGTATGCAAGGAATCTGAAATTTGTTTTGGTCCTTTTTGAGCAGATGTCAGGCCTCAAAATTAACTTTCACAAGAGTGAG
ATTCTGTGCTTTGGCAAAGCCGTAGATATGAAGAATTTGTACGCTGAAATCTTCACTTGTCCTATCAGAAATTTACCCATGAACTACTTGGGCATCCCCGTAGATTACAAGACTCTTAGA
ATCTCCCATTGGGCCAAAATGGAAGAAAAAATGGAAAAAAAACTGGGGGTCTGGCAAGGAAGGTATCTCAGCCTTGGGGGGAGGCTGGTGCTGATTAACAGTAGTTTGTCTAGCATCCCT
TTATACATGCTTTCCATTTTCTGGGCTCCTGTTAGTGTGCTCAAAAAACTGGACATGTATAGAAGGAGGATGCTATGGCAGGGGGAAAAAAAGAGCAATAAACCCCATCTGGTGAACTGG
GATATTGTTTGTAGGCCTAAGGATCAAGGAGGTCTGGGAATTTTAGACCTTAGATGCATGAACCTTTGCTTACTGGCCAAATGGTGGTGGAGTTTGGAGAATAAGGAGGGCTTGTGGCAA
AAAATAGTAAGGTTTAAATATATCAGAGGAAGACCTTTGAGTTTGATGCAAAGGAAACAAGGGGACTCTCATTTCTGGAAAAGCATTCTGGAAGTAAAAGATGTGTTTTACAAAAACTGC
AAAAGAATCATTGGAGATGGTAAATCAACCAGTTTTTGGAATGATTGTTGGTGTGGGAATACTCCTCTCTCGGTAAGATTTAAAAGACTTCATGACTTATCTCTTAATAAAGAGATAAGT
GTAGAAAAGGTGATAAGTACGAATTCTGAATCCTTAACCTTCAGAAGGAGGCTAGTGGGAGCTGGGGCTGACAATCTCAAGGAGATGATATCCTCATATGAGGACATCTGTCTTAATGAT
TCTAGAGATAATGTTATTTGGTTACTAGATAAAAAAGGATTTTCGGTCAAATCCCTTTACCTTAATTGTCGAAACAATTTGGGTCGGGTGCCTTATATGTTCATCTGGAACGCTAAAATC
CCCCAAAGGATAAAAGTTTTCCTTTGGCTTCTTTTGAGAGACAGGATTCTATCCAAGGCAAATCTGAGCAAAAGGAATTGGCAAGGAAACATCAATTGCACTTGGTGTGATTGCCTAGAA
ACTACGCAGCACATCTTCTTTGACTGTCAGATAGCAAAATTTACATGGAGAGTGGTGCAGATGGTGCTACATCCCATTTGTATTCCCATGAATCCCAGTGAGATGTTTAGCCACTGGCTC
CATCTTTTCAATAAACGAGACAGGAATTTGTTGACAGTGGGATGTAGTGCAGTTCTTTGGACTCTTTGGAAAATAAGAAACGAAGCTTGTTTTGATGATAAAAGAATAGTTAATACGTTA
GACATCTTTATATTGTGTTGTTTTTGGATGAACTCATGGATTTTATTACAGAAAAAATCGGCAAGAAGGATGCTGGAGGAAAGAAGCAATCATATCAGAAAAATGGCTAGTGAGTTCTTC
AGTCGAGCTTGGGGATGGTCTCCAGTTGACAGGAGGCTGACGCAGTGATCGGTTGAGTGGGGGATCCTTTTTGGCGATGATGCTTCTTTCTGTTCTTGAACCTAGAGACTCTTTTGGCTA
TTATATCAGGATGTCGGTCTGTAATAATGTCTTGGTTAAACCCCCTTTCTTGTCTTAGTCGTCTTGGTTTGGCAATAGATTTTAGGTCAGGTCTGATCATAGATGTTGCTGGATTAGTTG
CTGAGCTTTTGTTGCCAATGGCTTGTTTTGGCTAAGACATTTCTGGTGTGTGTAGGGGGGGAAACCCCTTTTCGTCAAAAAAAACACATGCTGCAACTATTGCATGCTTCCATTTCCAGG
GGTGCGATGCTTCCGTTCTCCTGAGGAACACCAGCGGCTCCAGCAACCAGACGGAGATGTTCGGCCTGCCCAACATAAACAGCCTCCGCGGGTTCCAGGTCATCGACGACGCCAAGGCCG
AGCTCGAGAAGGCATGCCCCCGCACGGTGTCGTGCGCGGACATCGTCGCCTTCGCCGCACGCGACGCCACGCGCAACCTCAGCTACGGCGCCATCGACTTCCAGATGCCGGCGGGACGCC
TGGACGGCCGCGTGTCCCTCAAGGAGGAGGCCGAGAAGAACCTCCCGGGGCCGTTCGACAGCCTCGACGACCTCCAGAAGAGCTTCGCGGCCCAGGGCCTCGGCTTCAACGACATGGTCA
CGCTCTCCGGCGCGCACAGCATCGGCGTGGCCCGCTGCAGGTTCTTCACCAACCGCCTGCCGCCTAACCCCTCGGACATGGACCGCGACCTCGCCAGGAGCCTAAAGGCGACCTGCGACC
AAAACGGACTCGACTCCAAGGTGGTGCAGGACCCCGTGACGCCAGTTGCCCTGGACAACCAGTACTATAAGAACGTGCACAACGGCAAGGTGCTCTTCACGTCGGACGCCGCGCTCAACT
CCACTGACGACGCAAGGAAGGTGGTGGACGGCTTCGCCAACAACGCGGTAGACTGGTACCGCGCGTTCGCCGATGCCATGGTGAAGATGGGCAACATCAGGGATAGGACCATCAACAGAC
CCAAGCCCGAGATCAGGGAGAAGTGCTTCATTTACAATACCTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGGTTGCCGCCCTGACGATCACCTTGCTCGGGCTCCTGGTGTCCGTGACATGCCAGGGCAGCACTTACCCTGCTCAGCAGCAGCAGGAGGCTTCGTCGTCGTCGTCTAGCCCT
GGTTGCATTCTGCGAGGGTGGATCCCGTTCTTGCCTCCTTGCCGCGACGACCAAGCCCCAACGCCAAACCCTCTCCCTCCTCCCTCAGGGGCAGGGCTCACCGTGGGCTACTACAAGAAC
TGCCCTGGCGCTGAAGGTATCGTGAGGGAGGCCGTGGAGAAGGCCATGGACAACGGAAACCGCGGCATTGGCGCAGGACTCGTTCGTATCTTCTTCCACGACTGCTTTGTTCGG
GGGTGC
GATGCTTCCGTTCTCCTGAGGAACACCAGCGGCTCCAGCAACCAGACGGAGATGTTCGGCCTGCCCAACATAAACAGCCTCCGCGGGTTCCAGGTCATCGACGACGCCAAGGCCGAGCTC
GAGAAGGCATGCCCCCGCACGGTGTCGTGCGCGGACATCGTCGCCTTCGCCGCACGCGACGCCACGCGCAACCTCAGCTACGGCGCCATCGACTTCCAGATGCCGGCGGGACGCCTGGAC
GGCCGCGTGTCCCTCAAGGAGGAGGCCGAGAAGAACCTCCCGGGGCCGTTCGACAGCCTCGACGACCTCCAGAAGAGCTTCGCGGCCCAGGGCCTCGGCTTCAACGACATGGTCACGCTC
TCCGGCGCGCACAGCATCGGCGTGGCCCGCTGCAGGTTCTTCACCAACCGCCTGCCGCCTAACCCCTCGGACATGGACCGCGACCTCGCCAGGAGCCTAAAGGCGACCTGCGACCAAAAC
GGACTCGACTCCAAGGTGGTGCAGGACCCCGTGACGCCAGTTGCCCTGGACAACCAGTACTATAAGAACGTGCACAACGGCAAGGTGCTCTTCACGTCGGACGCCGCGCTCAACTCCACT
GACGACGCAAGGAAGGTGGTGGACGGCTTCGCCAACAACGCGGTAGACTGGTACCGCGCGTTCGCCGATGCCATGGTGAAGATGGGCAACATCAGGGATAGGACCATCAACAGACCCAAG
CCCGAGATCAGGGAGAAGTGCTTCATTTACAATACCTACTGA

Retrieve as FASTA