1. Browse the Database
  2. View Redoxidase
Entry information : SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Entry ID 1783
Creation 2007-10-01 (Christophe Dunand)
Last sequence changes 2007-10-01 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Name (synonym) SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Rhizomes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrxII03
start..stop		 S start..stop
SpPrxII03 327 1.81e-117 1..162 1..162
ZmPrxII03 324 3.62e-116 1..162 1..162
HvPrxII03 310 1.11e-110 1..162 1..162
ScPrxII03 303 5.76e-108 1..162 1..162
Gene structure Fichier Exons►


exon

Literature and cross-references SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Literature Cordonnier-Pratt,M.-M., Suzuki,Y., Sugano,S., Klein,R., Lim,S., Liang,C., Sun,F. and Pratt,L.H. A Sorghum EST database: anaerobic roots.
DNA ref. Phytozome 12:   chromosome_3 (59282143..59279934)
EST ref. GenBank:   CX610141
Cluster/Prediction ref. UniGene:   Sbi.6951
Protein sequence: SbPrxII03 (Sobic.003G254300.1 [2.1] / Sb03g030950 [1.4] / SbPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162 (312)
PWM (Da):   %s   17256 (35092.6) Transmb domain:   %s   i7-29o144-166i187-209o
PI (pH):   %s   4.78 (5.68) Peptide Signal:   %s   cut: 19 range:19-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDSLPDGQLGWFDENDQLQQVSVHALAAGKKVILFGVPG
AFTPTCSNQHVPGFITQAEQLKAKGVDEILLIVNDPFVMKAWAKTYPENKHVKFLADGSGAYTKALDLELDLTEKGLGVRSKRFALLADDLKVTVANIEEGGQFTISGAEEILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 2 introns) and 14 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST