Entry information : NnPrx104(Nelnuc025006g574180)
Entry ID 17894
Creation 2023-02-08 (sebastien Cabanac)
Last sequence changes 2023-02-08 (sebastien Cabanac)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2023-02-09 (sebastien Cabanac)
Peroxidase information: NnPrx104(Nelnuc025006g574180)
Name NnPrx104(Nelnuc025006g574180)
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Nelumbonaceae Nelumbo
Organism Nelumbo nucifera (sacred lotus)    [TaxId: 4432 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NnPrx104
start..stop
S start..stop
NnPrx103 675 0 1..328 1..328
RcPrx26 451 6.14e-161 1..328 1..326
EgrPrx129 448 1.01e-159 7..328 8..323
EcamPrx129-2 442 1.58e-157 7..328 8..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '17894' 'join(20384157..20384369,20384470..20385243)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20384157..20384369 211 N° 2 20384470..20385243 772  
join(20384157..20384369,20384470..20385243)


exon

Literature and cross-references NnPrx104(Nelnuc025006g574180)
Protein sequence: NnPrx104(Nelnuc025006g574180)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (306)
PWM (Da):   %s   35230.78 (32827.6)  
PI (pH):   %s   9.07 (9.07) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTLFTLMVMFLASFMAPTVSSSASLKVGFYKNTCPSAEAIVRNA
VSKAVAANPAMAAALIRLHFHDCFVR
GCDASILLDSASGFPAEKVSMGNKGVQGFEVIDEAKAKIEAQCPNTVSCSDILAFAARDGVFKAGGIHYAVPAGRRDGRVSLASEVTKNLPDASFNVKQLKNNFARKGLSLEEMVTLSGA
HSIGDSHCSSFSNRLYHFNATHSQDPSLDPAYASYLKTQCPLHPTAKNNLDPVVPFDAVTPDRLDNNYYKNLKKHKGLLTSDQVLWIDPSTRKTVRGNMNHPAAWAAKFASAMVHMGSID
VLTGSQGEIRKKCIIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic
Promoter
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ACACAAAAAG TTTTGGTGCA TATTGTATGA TGAGTCTGGA TCTGGTCCTC ACACCAACCT CATAGCACAT CTCAGCCATG AATCAAGAAC ATCTTTTATA CTTGTGTATT ATTAATTTGT  TATTTATCGG GAGATGTTCC CAATAGACAG TAAAATGTGC TGTGAGGTTG GTGTAAGAAG TGTTCTGTAG AGAGCAAATC CCAATTCTTG TATAATACAT AGTTTTTTTT AGAGAATAGT  ACATATTGAC TTTTGAACCC ACCGACGCAC TAATTAGTAA GAAATAGTGA TAGCTCTTGA GTTTTAATAG TTGTAATAGT AGCAACTGGT AATGGGTGTT CACTGAAACT GACGGAAAAC  TTACATATGA AGTGCTCAAA ATGGACCACA TAAACGGACA TTAAAAGAGT GGTTCGGAAT GCCCAAGGCA AAGGGATCAC CACCAACTCA ACTTAAAGGG AAAATCTGCA CCCAATACAG  CGTGCCCCAT GGGCGCCCCA TATGTACATC TCAACATGCA TGAGAAACAT CTCTCGAAAT TATCATTAGA AAATGTTCCC AATAAATGGT TGGGATGTGC TGTAGGGTTT AAGTTAACAC  GGCCCAAATT GCAGCCCTAC TGTCCATGGG ATGTCCATAT GGGGTATGCC TCACAAATTT TAATTTTTCC AGGATCTCTC TCTTAACTGA GTAGCATAAA TAAGTAGAGT AAGAAACCTA  CTTTTTTTTT TTTTTCTAGT GAGAAACATT TATACTTGGA GATGTTTTCT CACCTATATT TTCAATAGAG TAAGAATTCT AGCGCATTCT TATTGTAAAA AAAAAAACTT GAAGATTTTT  TCTTACCTAT ATTTTCTATA GATTCTATCT ATTTGATGAA TTGCAACCTA GGCTCCATTT GGAAGGAGTA TAAATACATA TGTATTTAAA CAATATATAT TTGTATTTGT ACTTTTTTCA  AATTAGGCTC AGTTTAGAAG GAATACAATG CAAATATGTA GAGTGCAAAA CCTTGTATTT TGTATGTATT TACACTATAT ATATTTATAT TTATACTCTT TCCAAACTGA GCCTTGAGGC  ATATCACATA GGTTCTATTT TCAATAGTTT TTCTTTTTAT TTTTTATTTT TATAATTTTT CTGTAAACTT CTGTTTCCAA TAGAAATTAA TCCTCTATAC CACCATTTCA TTGCTCTTAT  GGGTGCATTG TGTTGGAGAA GTTATCCTTA TATTGATTTC TTTTCTGTTT TAGAGTGAGT AGGGGCTGTT AGGCACAGAC AACTTCCTTC CCCAGTTGGT TACTGCCCAG CTGAGCCACT  CTATAGGTTG CAACCAGTAT TCAAGAATGA CTGTAGAACG AATTAATTGT AGCCCAATAG ACACGGCTTC CGCCCATAGA GTCATAGACA CAGAAACCGA GATAACTCTG AATTTGAAGC  CGCCAACTTT GAAGACTGAG AAGTGAGAAC CCATTTTCAG GGGACCCAGA AACATAAACC TTGCTTTGCT TCTTCGGGCA CACTAATTTC TTCCAATTAA AACCTTAAAA CAGAGAATGA  AGCTATGAAT AAAGGGGGCC CAAGTCCTTC CAACGTTAGT ACAAGTACTG GGAAAGCAGA CAATATAAAA TTGTATACGT TGAGCTGGAA GAACTGCTCA AGTCTGTGTA CATGGAATGT  GTTGAGTGTG AGTCATCGAT TCCCTCACTT TTCTTAAGTA ATAATAATAT GAAAATGGAA CCACGTGAAC ACGCCTTTTA ATGGTTCACT GTAAATGTTT GTTCATTTAC GCTGTTTAGG  CCAAGATGCC ATTGGCTGAG AAGGTTCAAC CTGGCATCCT TTGCTTGGAG GACATTTTGC CCATTCACTT GTCACTATAA ATACATCAGC CCAGGCGTGT GTCCTCCACA CTCTCTCTCA 
TTCTTTCATC TTCAACCTCT CCTTCTGTGC ACAGGCAACA AGCTAGGATA ATGAATTGCT ATTGGGTCAG TTGGGCAGAG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
GTGTGATTTT GATTACATGT AACTAGAGAG AGACAAAGGT GTCTTTTCTT TGTAACAAGT CTCAATATTT ATGTGTTCTA TTTATGAAGT AATCAAGTGA ATTTTCGTTT GTTTAGTTCA  ACTACTTTGT AAACTATTTT ATCTATTGTT TTTAATGGGC TGCAGAACTG GGGTAACCCT CCCCCCAAAC CATTAGACAA GTTCACATCT ATCCCCCACA GAATGCGCCC CAAAAACATC  CCACATGCAC ATCTCAGCGT GTATTGACTG GGAGATGTTC CCAATACACA ATTGGAATGT GCCGTGAAAC ATTTTTGGAC GCATTCTGTG GGGGCAGATT TGAACTCCCC TAGACCCCCT  CAACCCGGTG AAGGCGGGAC TCAATCCCAA GTCTCAAACT ATATAGAGAG TTTAAATCGC TTAATTTGCA TTACAAGGCT TTTGTTATTA TCCTTTTTTT TATTTTTTTA TCTTGTGCAC  ATGCATAGGC AGATAGATGG TCTGAACAGT CCATCAAAGA AAATGAGTGG TGAATTAAAA TCTATTTGAT CACTTTTTCT GAGTGGTCTG AACGTCCAAC AGTTGAGTCC AGTCCAAGTC  TGGCAATTCA TATATGCATA ATTCAACCTT AACTCCAATT ACCTAGTCGG GATGTCATCA TTCTTCTATC AGAAGCTAAT TTTCAAATGA TTCTTTTCAT AATCTTCATT TCAATAGCAG  TTTATTTTCT TGGAAAACAT ATGGTAATTT GTAAGGTAGA GCCCAAATTT AGATGGAAAA CTATACTTAT CCAAAGCTTT ATTGTCATGT CATACTGCGA GGTTGCCCAT CAAAGCCAGA  TAGAGACTGA ATACGGTCAC CAAGTAAGCT ACATGATCTA CAAAGCTTTT AACATGACTG AAGAATAAGG TTTTGCGCGC AACTAAATGA GAGGTGTCTC CAATGAAACT CAGTAGATCA  GAAGTCAGGA TGTTGGATAA CTTCAGTGTC ATATCTAATA TCAACATTCC TTCTCCAGCT TAGGGTCATT CACCAACTGG GTACCTGATA AAGACATGAG AGCTTCAGAA AAATGTGGGC  TCTGGAATTT GTTTGGGATG CATTTAGTTG GGGATGGTAT ATGGCAAAAA CAGGTACTTT GTGAATGTTA GTATTTCGTT GCGAGAAGGA AATAAGGATC CTCAAAGAGG CACTGGGCTT  TATAAGGCCA CTTCTAACTA CTACAATATA TAGCCATCCA CCAAAGGATT TTTCTGTTGG AGGAATGGTG AGGCCCCAAA CCAATTCTTA ATACTTCACA ACCAGACGGT TTAGGCCAAG  TTTTGGCCAA GTAGAAGCTG ATATGGATGT AATGGGTTTA TGTATATCAG TCCCAATCTT AATGGTCCAA ATTAAGAAGT CTTATTTTGG AGATTTCCGT TGCAATACTT TAAGGCCTTG  TTCATTTGTA ACAGTGCAAC TATCCAGGTA AATGTTTCAT TTACCTGGAC AAGTGCACTT GCCCATGTTC TTTTGATTTT TAGGATTCCT AGGTAAATAA TAAAATGACA TTTCCACTCA  CAAAAGTAAC TATTAAAATG GATAAAATGG TCCCATCATG TTTTATAAAA ATTTCTCCCA GCTAGGAAAG TTACTTTTCC CACCTGGGAG ATATGTAAGT AACTTTACTG TGGGCACATT  GCTTAATGCA AAAAGAACAT GGGAAAGTTG GTCAATGGGA AAAACCACTG GCCAACTTTC CCATGCATAT TCACCTGCAA ACGAACGGGG GCGTAAGGGA AAATTGAGAC AATGACATCA  TGATCTCCCG CATCAATGAA GTCTGTCAAC CCTATGTATT ATACAATAAA AATAGAACCA CAAATTGTGA AACCAGAAGT ATCAATATAA TATAATAAAT CTTGGAAAAA ATTGTAAATA 
TAACAAACTA AACTCATATG TACATACCAA AATTGTTTAA GTGCAAGTGG GTTACATAAT TCATTTGTTC TTTCTCCTTT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTACACTGTTCACTCTTATGGTAATGTTTCTTGCCAGTTTTATGGCTCCCACCGTGTCATCTTCAGCCTCCCTCAAGGTGGGTTTCTACAAGAATACTTGCCCATCTGCAGAGGCC
ATTGTGAGGAACGCAGTTAGCAAAGCTGTTGCTGCTAATCCTGCCATGGCTGCTGCTCTCATTCGGTTGCACTTCCATGACTGCTTTGTCAGG
GGGTAAGCTTTTGCCTTCTCCTTCATT
AATATTATTTTTTCTACTTTTCAAATCTCAATTGCACTTGTTAATTAAGGTGGGGTTTAATTTCTTGTGTTGCAGGGCTGTGATGCTTCTATTCTTCTGGACTCAGCGTCAGGGTTCCCA
GCTGAGAAAGTGAGCATGGGCAACAAGGGTGTGCAAGGCTTCGAGGTGATAGACGAGGCCAAGGCCAAGATTGAAGCTCAATGTCCCAACACTGTATCTTGTTCAGACATCCTTGCCTTC
GCAGCTCGCGATGGCGTATTCAAGGCCGGAGGCATTCACTATGCAGTCCCTGCCGGCCGGCGGGATGGCCGAGTTTCACTAGCAAGTGAGGTCACTAAGAACCTCCCTGATGCATCCTTC
AATGTGAAACAACTCAAGAACAATTTTGCACGAAAGGGGCTCTCACTAGAGGAAATGGTGACACTCTCAGGCGCCCATTCAATCGGGGACTCTCATTGCTCATCCTTCTCAAACCGCCTC
TACCACTTCAATGCCACACACTCCCAGGATCCTTCTCTTGATCCTGCCTATGCCAGTTACCTGAAAACTCAGTGCCCATTACATCCAACTGCTAAAAATAATCTAGACCCAGTTGTACCA
TTCGATGCAGTAACCCCAGATCGTCTAGACAACAATTACTATAAGAATTTGAAGAAACACAAGGGACTGTTGACTTCAGACCAAGTGCTCTGGATTGATCCCTCAACAAGAAAGACGGTG
AGAGGCAACATGAATCATCCAGCAGCCTGGGCTGCCAAATTTGCATCTGCCATGGTCCATATGGGTTCGATTGATGTGCTCACTGGGTCGCAAGGCGAGATTAGGAAGAAGTGCATAATT
GTGAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTACACTGTTCACTCTTATGGTAATGTTTCTTGCCAGTTTTATGGCTCCCACCGTGTCATCTTCAGCCTCCCTCAAGGTGGGTTTCTACAAGAATACTTGCCCATCTGCAGAGGCC
ATTGTGAGGAACGCAGTTAGCAAAGCTGTTGCTGCTAATCCTGCCATGGCTGCTGCTCTCATTCGGTTGCACTTCCATGACTGCTTTGTCAGG
GGCTGTGATGCTTCTATTCTTCTGGAC
TCAGCGTCAGGGTTCCCAGCTGAGAAAGTGAGCATGGGCAACAAGGGTGTGCAAGGCTTCGAGGTGATAGACGAGGCCAAGGCCAAGATTGAAGCTCAATGTCCCAACACTGTATCTTGT
TCAGACATCCTTGCCTTCGCAGCTCGCGATGGCGTATTCAAGGCCGGAGGCATTCACTATGCAGTCCCTGCCGGCCGGCGGGATGGCCGAGTTTCACTAGCAAGTGAGGTCACTAAGAAC
CTCCCTGATGCATCCTTCAATGTGAAACAACTCAAGAACAATTTTGCACGAAAGGGGCTCTCACTAGAGGAAATGGTGACACTCTCAGGCGCCCATTCAATCGGGGACTCTCATTGCTCA
TCCTTCTCAAACCGCCTCTACCACTTCAATGCCACACACTCCCAGGATCCTTCTCTTGATCCTGCCTATGCCAGTTACCTGAAAACTCAGTGCCCATTACATCCAACTGCTAAAAATAAT
CTAGACCCAGTTGTACCATTCGATGCAGTAACCCCAGATCGTCTAGACAACAATTACTATAAGAATTTGAAGAAACACAAGGGACTGTTGACTTCAGACCAAGTGCTCTGGATTGATCCC
TCAACAAGAAAGACGGTGAGAGGCAACATGAATCATCCAGCAGCCTGGGCTGCCAAATTTGCATCTGCCATGGTCCATATGGGTTCGATTGATGTGCTCACTGGGTCGCAAGGCGAGATT
AGGAAGAAGTGCATAATTGTGAATTAG

Retrieve as FASTA