Entry information : NnPrx106 (Nelnuc025001g0226340.t1)
Entry ID 18227
Creation 2023-02-20 (sebastien Cabanac)
Last sequence changes 2023-02-20 (sebastien Cabanac)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: NnPrx106 (Nelnuc025001g0226340.t1)
Name (synonym) NnPrx106 (Nelnuc025001g0226340.t1)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Nelumbonaceae Nelumbo
Organism Nelumbo nucifera (sacred lotus)    [TaxId: 4432 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value NnPrx106
start..stop
S start..stop
NnPrx43 532 0 19..325 17..323
GrPrx38 509 0 1..325 1..323
VvPrx35 499 3.35e-180 16..325 17..326
CclPrx113 499 6.05e-180 21..325 14..318
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '18227' 'join(48737227..48737460,48738300..48738491,48738594..48738759,48738974..48739359)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48737227..48737460 232 N° 2 48738300..48738491 190 N° 3 48738594..48738759 164 N° 4 48738974..48739359 384
join(48737227..48737460,48738300..48738491,48738594..48738759,48738974..48739359 )


exon

Literature and cross-references NnPrx106 (Nelnuc025001g0226340.t1)
Protein sequence: NnPrx106 (Nelnuc025001g0226340.t1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (294)
PWM (Da):   %s   33676.65 (30605.0) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.7 (7.70) Peptide Signal:   %s   cut: 32 range:32-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVAIASPSSSSISLLWVIAMLVLSVGMVSAQLSSTYYDTSCPKA
FSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVN
GCDGSILLDDTSSFTGEKTATANANSVRGFDVIDTIKSKVESVCPGVVSCADILAVAARDSVVALGGPSWTVQLGRRDATTASLSAANSDIPAPTLDLSDLTSAFSKKGLTAKEMVALSG
AHTIGQARCTSFRSRIYNETNINSSLATSLKSNCPSTGGDSNLSPLDATSPTAFDNAYFKNLVNNKGLLHSDQQLYNGGSTDSQVSSYSSNSATFSSDFASAMVKMGNISPLTGSNGEIR
TNCRKTN

Retrieve as FASTA  
Remarks complete from genomic
Promoter
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
GTGGTTGAGC CTAATGTACC AGCTGTCCTT GGCCTATCTT AATTGCGTTA TTATGTCCAC AGTCTACACG CACACACAGA TACACATATA CATATATACT TGGATATTAA GCATACCCTG  TAGATAAAAC TTTGTGAAAG AATAGAAGAT TTGAATGGTA GACAGGAGGA AGTAGCTTTC AATAATCAAA TTCATTGTAG AAATTAAAAT TACCACGGAT TGGACGCTGG AATGGCAAAC  CATATCTATC ACCATAAGCT TAAGGAGTGT GTGGGGTAGG GAGGGCAATT TCTACCCTAG CCCGCCAAGT ATCCACCTCT ACCATGGGGT GGGTTCTTTT ACTTGAAAAA CAGATTTTGG  GGTGGGTATG ACTTTGGGGA TTTTACAAGT TACAACCCAT ATAGATATAG GTAGGGTACA GTATTAGACT AAGTCAAATC CTCCCTGATC TATGTATTGT TGGAATGAAT ATGGATTAAT  GTATTAGGTG TTTAATTTAA TAATATTTTG GATTTTATTT GAAGAATAAT TGATAATTTA TGTATTGTTT GCATGTTTTA ATTAAATAAT TAAGAATTTT GAATTATGTT TATGTTATTT  TATTACATAT AATAGAAAAT AATAGAAGAA ATTAGATGTA GATTCTAGAC TCAACCTGCC ATCCAACCCA CCCCACCCTC TAATGAGGGG AGGGTAGTGT TGGGGAGAGT TGCATTTTCA  TGTGTGGGAA AGGGTCACTG TTGCCATTCC TAGAGTGGGA TTCTTCAAAT GTATATCAAA AGGCTTTCTT AGTGCGCAAG GTCATTTAGG CCTCCATGGT TTTTTCCTTG GTTTCTTTGC  ACCATTCAAA CGTTATGAAG ATGACATTTG TAATAGACAA GTCAATCCAG ACCCGACCCG TCCCGACCCA AACTGCACTT CTACCTCTTA GTTCTACTAA TTCGTTGACG TTGGACAAAC  AGTTATAAGT TTGGGGAGGT TCCAAATGAT AGCTTAGAAG TTAAATAGGC AGCAGATGAT AGATTCTTTT TCTACCGATT TTAATTATAT TGACCAAAAA TCCACCAAAT CGAGAGTGAG  AGATCCCAAG TGGTGGTTCC GTTCACACGC TCCTCTGATT AAACACCCTT GACATTTTAA AGAAATACCG AAATTTCACT ACTTGTACCA CTAATTAAGA CCTAATCTTA AATACTCAAA  GCTTGAATGG TCGAGGCTTT CTTGCTGGTT TCGTTGATTC CTCCTACAAA TTCAAGATGA AAGATGATTG GGTTCACTCC TACCTAAAAG ACTAAGGTTG TGTTTGGTTT GAATGAAAAA  GTAGAAAAAG GTAAGAAAAC CTTTACAAAC TTTGTATAGA GTTTCTTATC TTTCCCTTCT TTTTCCTTCA AACCAAACAT AGCCTAAGAG ATTGTGTCCA CCTAAGGCTG TATTTGGCTT  AAAAGAAAAA GGTATAGGAA CTTCCTTTTC CTACCTTCTC TTTCAAATTA ACCAAACACA GCCTAAACAG AAAAGAAAAG GAAGACGTTT GGGCATTGGA TAACTAATGC CCAATGGCTA  TGTCATTCAT CTAAACGAAG AAAATAGAAG AAGGATCGAG TAATTAAACG ATCGAAGCCC TTGGGATTTT GTATTTATCT GTCAAGAGTG AGGGTATTTT CGAACTAATA ATAATAAAGC  AGTAGGTGTA GGTGCAGACG AAGAGATACG ACCGGGCACT TAAACAAAAG AGTAGTGGGA CTGGGAGGAT TCAGATTAGT TAACCTTTAC AAATTGTACT CTTGTTTTTT GACCTTTGGC  TGATGATGGC AGCAAATAAA GTAGCTAGGA AATGCACAAA CCGCCCACTA TATATGAGCA TAAGAATTAT TATAAATAGG GATCGAGTCC AGAGTCCAGA GAGTCGACCA ACACCAAAGC 
ATCTCCAAGG CATGCAATAA GCAGCTAAGG CTAAATAATT TTATCAGTGG TACTGCAGGG TAGTTGTGTA CGTGAAGTCC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
GCCGTCCTGG CGATCACACT CCACACTGTT TTGTCTACTC TGTTACTTAA GCTGCAGATG TAGCCTAAGA AATAAAATAA AATAAATTGG GATTGCTGCT TATAAATGTT GTGCAATTGG  TGTCCATTAC AGTGAACTTG TTCACTGTTT GTTCTATATA TATATGACTG ATCAAAAATA TATTTTTGTT TTGGTCTCTG GATTTAAGCT ATTTCTTTCT TGACATGTTT TTCAACGTTG  TTAAAGGCTG TGTTTGGTTG CAGTGCAAAT TTATTTCCAC TGATGCAAAA CTATGACAAT ACAAATGTTT TGGGTGTAAA TTTTAATTTA TTTTTGTTTC AAAATCTACC TTATTCGTTT  GGTTGTAGTA ACAAATGAAG TAAAATAAGA CCTAAAACAG AATAAAGTAA TTAAATTCAA AACAAAATTA AATCAAAGTT TGCATTTTTT TCATTTGCAC TCCCATACAT TTATACTAGT  CAAATAAAAT CGCATTGCAA CCAAACACAG CCAAGGCATT ATCTTGGAGA AATTCCACCC TTTCTCCCTA GGTTCAAATT AGGGATGTCA ATGAATTGGG TTAAATGGTA AACTCGGCTT  GAACCGACCC TATAGGGTTA GGTTAGGGTC AAGTATATTT GTTTTAAGGT TGGGTTAAGG TGTTGATTCT TTGACCTGAG TTGGGTTCGA TTTTTTGTTG ACCTGCCTCA CCAGGTCATG  ATACCTTGCA TATATACCAA GTATTCTTGG AATTTTTTGA CTTTGAACTT TATAGACTCA AAGTTTATAA TTTATTTATT TGTAGATTTT GATTTTCTTT TTTTTAATGG AAAAAAATAA  TACCTTAAAA TCTATAAAAC AATTTCTTTA TTTAAATTAA TATATTGTAG GTCTTCAAAA TGTGTTAAAA AATACATTTA AAATTATATG GGTCAAGTTA AGCCAGAACC AAGTTAAACC  CTAAAGGGTC AAGTCAGGTT CGGTAATCAT GTATTTTTTT TAAGTCAGGC TGGATTGGAT TTGGGATGGA GTGCTGGAGG GTCGGGTTAG GGTTGAGGCA AACCAACGCC AAACCTGACC  TGTTAACATC CCTAATTCAG ATTAGTTTAA TGCGATGGCT GAGGGTAAAC CCCCATGGTT CATGCTAGGG AGAGCTTGAA TGGCTGTGGG TCGTACGTTT TTTTTGACCT GCGTGGGGCC  TTATCATTGG TTCTACAGCA CGCTACACAG CCATAGCGTT CAGTTAATCC TATCTCCAAA CAAACAAATT AAAAAAAAAA AAAGAAAGAA AAGGAAAAAT TTTGGGACGA ATTAAAATAT  GATTTTCATT ATCCACGCTA AAAATTAATA CGAGACACAT CTACGTACTG CTGATTACAT GATCTGTTTT TAATTTTCAT CGCTGTCCGA GTGCAAAAGT GCAGGGGATT AAATCCTAAA  TTTAGCACAA ATCCAATTCA AGTTTCTTCA TTATTTTATG AATTAGGAAT AGAAACAAAA ACGTTTATTT GTAATATTTT TTCTTACTGT TATGAATTAA ATTTAGCCTA TTGAAATCAA  ACCCAATATG GGACAATTGA TTGATAAAAA TGAAAAATAA AAAATAAATA CATTTTAGCT TTATAAATAC ATTTTTAACT TTACAAAAAA AAGTATAAAA ACAAAATGAA AAAAAGAATA  GAAAAAAAAA ACACTTCTGA TGGATCATAA CATTTAACAG AAAAAGCTAT TGGATGACGA AAAAGCTTTA TTACAACTAG TTAAACAAAG GACCAACCAG TCACAAGTTT TGTTGGTGGA  ATTTTTTTAG GGATTCTAAA AGAGAAGGGC AACTTTTGGG CCTTAATATC AAATTATAAA GACCCCCTTG TATTATGGGG TTAGTGACAA AGATCCCTTA TACTTCAGTT TGCAATAAAA 
ACTCCCTCTG TTAGTATTGC ATCAGTTAAC TTCGAAAAAG ATTATTGTCC AACTGTTTAA AGTTTTCTAA ATACTCAAAC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGGCAATTGCATCTCCCTCCTCCAGCTCTATAAGCTTATTGTGGGTGATTGCCATGTTGGTACTCTCGGTGGGGATGGTATCCGCTCAGCTATCCTCCACATACTACGACACT
TCATGCCCCAAAGCCTTTTCTACCATTAAGTCTGGCGTGACCGCTGCTGTTGCCAAAGAGAAGCGCATGGGCGCTTCCTTGCTCCGTCTCCATTTCCACGATTGTTTCGTCAAT
ATGCAA
GTCCATGCCTCGCTCTTACCTACTAATTTAAATTTAACATTTCCATTCTTGAGAGTCTCTCTCTCTCTCTCTGTGTTAGTCTTTATACCATGCATGCACGTACGTAGTTTTCTTTGCAAT
ACTGAGTCTTCAACACTTTCCCCAGTTCGAAAGGAGGTTCGTCCTTTCCTATATCACTTAGCATTTGGTTTCACTGCATTTACTTTCATCATCGTTCTCGTTATAGAAAAAACCCAGCTA
TATATGTTCATCAAAGCCCCAAAGGAAAACCAATATCAATGGCCAGTCTAAAGCTGCCAACCATGCATGCATGCAACTTCTAATTTCCTTGCTGGAAACGCGGATTCATGCACAGATTGG
GTTCATTTTGAGGCGAAATCGATTTGTCTGGTTTTTATCCTATACATCAACATTAACAGGGCACAAGTCTTGACAACCACCCACCACACCAAGCCCTTACTTTCTTCTTTCATTTGTTTT
AGCTAAAAGCAATAGTACATCATCGAGTTATAGACCCAAGTCAATTCATAAATAATAGGCCCGGTGTGGTACTGTAGATTGAAAAGTAATTTCGTCCCGTCCCTTTTGAACTCGATCGAG
CCATGCATGCATCTATGTAAATCATCCCGATCAATTTCTGTCCCGACCGGCCCCTAGATTCCTTAACACCCTTTTTTTTTGTTTCAGATAGACAGGAGGAATCACCCGGGCCTCTACATA
GAATATTCTATGTACATGTCCGTAATATGAGAGAGAGAGAGAGAGAGAGAGAGATTTATATACAATACTTAGCAGGTAGGAGAAACCAAACGATATATGTGTGTGTTTTAAACAGGGATG
CGATGGATCTATACTGCTGGACGATACCTCGAGCTTCACGGGGGAAAAGACGGCAACCGCAAATGCAAATTCAGTGCGAGGGTTTGATGTGATCGACACCATTAAAAGTAAAGTGGAGAG
TGTGTGCCCCGGTGTTGTTTCCTGTGCAGATATTCTTGCTGTTGCAGCTCGGGATTCCGTTGTTGCT
CTGTAACAAGCCAAAACCCTCACTTTCTTTTGTTCGATCATATATAAGCACTA
ATTTGTGATTTTTGCATGGTAACGATGGTGTTGCATGTTTTGATGTTTCAGTTGGGTGGGCCTTCATGGACAGTACAGTTGGGCAGAAGAGATGCGACCACAGCAAGTCTAAGTGCTGCC
AACAGCGACATCCCTGCTCCAACCTTGGATCTTAGTGACCTTACATCCGCTTTCTCAAAAAAGGGTCTTACTGCCAAGGAAATGGTCGCTCTTTCAG
AGGTAAGTAAAACCAGTACAAAT
GCCAAGAGCATTTGGATTCTCATCTCATCTGTCCTTCTGAATTAATTCAAGTGGTTGTCAAATGCTCTGTTCCATTAGCTGAGTACTACGTACAATCCATGCCATGAATGAATCCATCTG
ATCATTAATTCTCCTTAATTAATTATATATCATATATCTTCTTCTGTTTTAATTTGTTTGTATATATGCATAGGAGCTCACACCATAGGGCAAGCTAGGTGCACAAGTTTCAGGTCTCGC
ATCTACAACGAGACTAATATAAATTCTTCATTGGCGACATCATTGAAGTCCAACTGTCCGAGTACTGGTGGAGACAGCAATCTCTCTCCCCTTGACGCTACAAGCCCTACAGCTTTTGAT
AATGCTTATTTCAAGAATTTGGTGAACAACAAAGGACTTTTACACTCGGATCAGCAGCTCTACAATGGTGGCTCCACAGACTCTCAAGTTAGCTCTTACAGCAGCAATTCCGCAACCTTC
TCTTCAGATTTTGCAAGCGCAATGGTGAAGATGGGCAATATTAGCCCGCTCACCGGCAGCAACGGTGAAATAAGGACCAATTGCAGGAAAACCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGGCAATTGCATCTCCCTCCTCCAGCTCTATAAGCTTATTGTGGGTGATTGCCATGTTGGTACTCTCGGTGGGGATGGTATCCGCTCAGCTATCCTCCACATACTACGACACT
TCATGCCCCAAAGCCTTTTCTACCATTAAGTCTGGCGTGACCGCTGCTGTTGCCAAAGAGAAGCGCATGGGCGCTTCCTTGCTCCGTCTCCATTTCCACGATTGTTTCGTCAAT
GGATGC
GATGGATCTATACTGCTGGACGATACCTCGAGCTTCACGGGGGAAAAGACGGCAACCGCAAATGCAAATTCAGTGCGAGGGTTTGATGTGATCGACACCATTAAAAGTAAAGTGGAGAGT
GTGTGCCCCGGTGTTGTTTCCTGTGCAGATATTCTTGCTGTTGCAGCTCGGGATTCCGTTGTTGCT
TTGGGTGGGCCTTCATGGACAGTACAGTTGGGCAGAAGAGATGCGACCACAGCA
AGTCTAAGTGCTGCCAACAGCGACATCCCTGCTCCAACCTTGGATCTTAGTGACCTTACATCCGCTTTCTCAAAAAAGGGTCTTACTGCCAAGGAAATGGTCGCTCTTTCAG
GAGCTCAC
ACCATAGGGCAAGCTAGGTGCACAAGTTTCAGGTCTCGCATCTACAACGAGACTAATATAAATTCTTCATTGGCGACATCATTGAAGTCCAACTGTCCGAGTACTGGTGGAGACAGCAAT
CTCTCTCCCCTTGACGCTACAAGCCCTACAGCTTTTGATAATGCTTATTTCAAGAATTTGGTGAACAACAAAGGACTTTTACACTCGGATCAGCAGCTCTACAATGGTGGCTCCACAGAC
TCTCAAGTTAGCTCTTACAGCAGCAATTCCGCAACCTTCTCTTCAGATTTTGCAAGCGCAATGGTGAAGATGGGCAATATTAGCCCGCTCACCGGCAGCAACGGTGAAATAAGGACCAAT
TGCAGGAAAACCAACTAA

Retrieve as FASTA