Entry information : ZmPrx11(Zm00001d032854 / GRMZM2G130904 / peroxidase R11)
Entry ID 184
Creation 2006-07-13 (Christophe Dunand)
Last sequence changes 2006-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-03 (Christophe Dunand)
Peroxidase information: ZmPrx11(Zm00001d032854 / GRMZM2G130904 / peroxidase R11)
Name ZmPrx11(Zm00001d032854 / GRMZM2G130904 / peroxidase R11)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx11
start..stop
S start..stop
SbPrx06 553 0 1..328 1..326
ZmPrx86 525 0 7..328 4..331
SiPrx159 522 0 1..328 1..326
OsPrx126 485 1.71e-174 6..328 3..326
Gene structure Fichier Exons


exon

Literature and cross-references ZmPrx11(Zm00001d032854 / GRMZM2G130904 / peroxidase R11)
Literature Padegimas,L.S. and Reichert,N.A. Isolation of genes and regulatory sequences implicated in hypersensitive response from Zea mays nematode-resistant line MP307. Unpublished
Protein ref. UniProtKB:   Q9ZTS4 [Fragment]  B4FQI9 [Mismatch]
DNA ref. GenBank:   AC210097.1 (26353..27700)
mRNA ref. GenBank:   BT039377  AF037162 [Fragment]
Cluster/Prediction ref. UniGene:   Zm.101250
Protein sequence: ZmPrx11(Zm00001d032854 / GRMZM2G130904 / peroxidase R11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   35298.29 (32107.8)  
PI (pH):   %s   5 (4.75) Peptide Signal:   %s   cut: 29 range:29-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEHSLYYYCRSWLLVCSSVLALCLGSRGQLTPGFYRSTCPQLYYT
VQRHVFDAMRAEMRMGASLLRLHFHDCFVN
GCDASILLDGDDGEKFALPNRNSVRGFEVIDAIKADLESVCPEVVSCADIVALAASYGVLFSGGPYYDVLLGRRDGLVANQSGANSGLPSPFEPIDSIIHKFAAVDLNTTDVVVLSGAHT
IGRARCALFSNRLSNFSATESVDPTLDAGLAESLQSLCAGGDGNQTSALDVSTPNAFDNAYYKNLLLEKGLLSSDQGLFSSPEGVARTKALVETYSQDSEHFFCHFASSMIKMGNIPLTA
SDGEIRKNCRVAN

Retrieve as FASTA  
Remarks Completed sequence from genomic (chromo 1, 3 introns) and 11 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST