Entry information : OsAPx03(APX3 / LOC_Os04g14680)
Entry ID 1867
Creation 2006-09-05 (Christophe Dunand)
Last sequence changes 2012-05-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-11 (Christophe Dunand)
Peroxidase information: OsAPx03(APX3 / LOC_Os04g14680)
Name OsAPx03(APX3 / LOC_Os04g14680)
Class Ascorbate peroxidase    [Orthogroup: APx2005]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Pannicles
Roots
Seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsAPx03
start..stop
S start..stop
SiAPx10 489 3.77e-177 3..291 4..292
ZmAPx03 481 6.79e-174 3..290 2..289
SbAPx03 480 1.1e-173 3..290 2..289
BdiAPx06 479 3.93e-173 2..290 3..293
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1867' 'complement(join(8198301..8198504,8198805..8198907,8199065..8199144,8199239..8199321,8199593..8199641,8199736..8199801,8200118..8200167,8200299..8200423,8200568..8200683))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8200568..8200683 114 N° 2 8200299..8200423 123 N° 3 8200118..8200167 48 N° 4 8199736..8199801 64
N° 5 8199593..8199641 47 N° 6 8199239..8199321 81 N° 7 8199065..8199144 78 N° 8 8198805..8198907 101
N° 9 8198301..8198504 202  
complement(join(8198301..8198504,8198805..8198907,8199065..8199144,8199239..8199 321,8199593..8199641,8199736..8199801,8200118..8200167,8200299..8200423,8200568. .8200683))


exon

Literature and cross-references OsAPx03(APX3 / LOC_Os04g14680)
Literature Teixeira,F.K., Menezes-Benavente,L., Margis,R. and Margis-Pinheiro,M. (2004) Analysis of the molecular evolutionary history of the ascorbate peroxidase gene family: inferences from the rice genome. J. Mol. Evol. 59 (6), 761-770.
Protein ref. UniProtKB:   Q0JEQ2
DNA ref. GenBank:   NC_008397.1 (8200683..8198304)
Cluster/Prediction ref. UniGene:   Os.4987
Protein sequence: OsAPx03(APX3 / LOC_Os04g14680)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   291
PWM (Da):   %s   31970.41 Transmb domain:   %s   o262-284i
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAAPVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLEPMKQKHPKITYADLYLAGVVAVEVTGGPTIDYVPGRRDSS
DSPEEGRLPDAKK
GAAHLREVFYRMGLSDKDIVALSGGHTGKARPERSGFDGAWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYADEDAFFRDYAESHKKLSELG
FTPPRSAFIYKSCQKPKSLLMQTAAGVAVAAAVVAWAYLCESNKRLG*

Retrieve as FASTA  
Remarks Complete sequence from 11 ESTs and 1 genomic (Chrom 4, 8 introns) and 15 ESTs. Strain="japonica" and "indica"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGGCGGCGCCGGTAGTGGACGCGGAGTACATGGCGGAGGTCGAGAGGGCGCGCCGCGACCTGCGCGCCCTCATCGCCAGCAAGAGCTGCGCTCCCATCATGCTCCGCCTGGCGTGC
GTTGCCGTTTCATCTTCTTCTTCTTCTTCCTTTGTCTCTGCTGTCCTTGCTATGCTCCACGATCGTGTATGTCTAGCTCGCCGCTGATGTCGTCTGCTCTGGCGCCGCCGCCGCCGCCGG
CCGCCGCTGTTTTTGCGCAGGTGTGGCACGACGCCGGCACGTACGACAAGGCGACGAAGACGGGAGGGCCCAACGGCTCCATCAGGTTCCCGCAGGAGTACAGCCACGCCGCGAATGCGG
GCATCAAGATTGCTATTGATCTGCTAG
GTCTGTGCATGTTTCTGTCAGATTCTTGTTCAGGATGTGAACTTGTTTTTTGATGCTGTTGTTGTTAATTTTGTTCTGACCTTAACAAGTTTG
ATTTGAGATGATATATATGGTTCTTTCATGTGGTGCAGAAAACCGATGAAACAGAAGCATCCCAAGATTACCTATGCTGACCTGTATCAGGTAACTCAGCTGCATATTTGAACACTAACA
AGTAACCTTACAATGGGCCTGTTCGGCAGCTCGATTACGCAGCTGTTTTGGCTGTGCTGTACAGCCCAGCCGTTCGTCTGCCTGTTGGCTGGCAGCGGCCTGGCTGTTGGCTGCCTGCAG
CCTCTACAGCCGCTGTTAGCTAGCTGCTGTAGCACTGTAGCTGCTGCTGCCGTGCAGCTGCAGCGCTGCAGCAGCAATCTCATCCGAACAAGCCCAATCCTACTTTCCTGCTGGTAAACT
TCACCAATCACATACCAATTATAAATCTCATCACCTCTAATTTCAGCTCTTGCCGGAGTTGTTGCCGTTGAAGTCACCGGTGGGCCAACTATAGATTATGTTCCTGGCAGGAGGGTGAGT
TGATGCATCGACATTGATTTTTTTTCCAGACTGAATATCTTATGAAACCATCTTGAGTTCTCCTTTTTTTTTTCTCATTTATCTACAGGAGATTCTTCAGATTCCCCAGAGGAAGGCCGT
TTGCCAGATGCTAAGAAAG
GTTGATTCATGACCCGTTATCTCTGCTCCTATCTACTAATCTAAAATAAAATATCAGCTCCAATGCATTGATACTTTTTTCTGTGATTTCTTGGGTTAATT
TTGCTAATTATAAATGATTAAATGAAATGAGCGCTGAAACCTTCCAATATGTTGTATGCACAAAGTTCAGATGATACAATTAAATTCGAAATTTTGTTTTTCTGGATAATTTGCTTCAAA
AATGTCAAAGGTATTTAGTTTCTTGTACTATATTTTACTTTTTTGAAAAGGTGTGCTGCGCATCTGAGGGAAGTCTTCTACAGGATGGGCTTATCAGACAAGGACATAGTAGCACTCTCA
GGCGGCCATACTCTC
GTATGCAACATCATCTTTCTACTGGTGTATATAATATATCAACTACTATTTTCCAGCTAAATTAGAGATCATGTTCTGAATAGTTCATTTTCAGGGGGGAAAGCT
CGTCCCGAAAGATCAGGATTTGATGGTGCCTGGACAAAGGATCCACTGAAATTTGACAACTCCTATTTCAT
GTAAGATTAAATATGACTTGTCCCTCCACAGAATTAATTATTGATGGTG
CTTGGACAAAGAATCCTCCGAAATTTGATAACTCCTATTTCATGTAATATTAAATATGACTTATCCATCTATAGAATTAATTAAATATCACCATTTGCTTCAATGCAGTGTGAGCTTCTG
AAAGAGAATTCAGAAGGGCTTCTGAAGTTGCCTACTGACAAGGCTCTTGTTGAAGATCCTACATTCCGCCGCTATGTCGAACTATATGCCAAG
GTACATCGCATTTATATCCCAAATCTT
TTCTATTCACTGTAACATTTCAGGTAGCTTATCAGGATGGTAATTAATTTTTTTTCTTTTCTGAAAATCGTAGTGCTTCTGTAAATGTCATGTTTTCCTTTGTTATGGTAATCACAATAG
TTTGTAAACTATAAACTTTCTGATAGATTGCATTAGTATTGCACAAATAGAAACCTAACCAGAATGATGTGTGCAATGAGCAATTGAGCATTCTCTAGTTAGTAGTTAATGAGTTCTTGA
TTTGCTAACAATAATTTGTATTTTTCTTTGTAGGAGACGAAGATGCATTTTTCAGGGACTATGCAGAGTCGCACAAGAAGCTATCTGAGCTGGGGTTCACGCCTCCTCGCTCTGCATTCA
TCTACAAATCATGCCAGAAACCAAAGTCCCTGTTGATGCAAACTGCAGCTGGGGTTGCAGTTGCTGCTGCAGTTGTCGCATGGGCTTACCTCTGTGAATCCAACAAGAGGCTTGGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGGCGGCGCCGGTAGTGGACGCGGAGTACATGGCGGAGGTCGAGAGGGCGCGCCGCGACCTGCGCGCCCTCATCGCCAGCAAGAGCTGCGCTCCCATCATGCTCCGCCTGGCGTGG
CACGACGCCGGCACGTACGACAAGGCGACGAAGACGGGAGGGCCCAACGGCTCCATCAGGTTCCCGCAGGAGTACAGCCACGCCGCGAATGCGGGCATCAAGATTGCTATTGATCTGCTA
G
AACCGATGAAACAGAAGCATCCCAAGATTACCTATGCTGACCTGTATCAGCTTGCCGGAGTTGTTGCCGTTGAAGTCACCGGTGGGCCAACTATAGATTATGTTCCTGGCAGGAGGGAT
TCTTCAGATTCCCCAGAGGAAGGCCGTTTGCCAGATGCTAAGAAAG
GTGCTGCGCATCTGAGGGAAGTCTTCTACAGGATGGGCTTATCAGACAAGGACATAGTAGCACTCTCAGGCGGC
CATACTCTC
GGGAAAGCTCGTCCCGAAAGATCAGGATTTGATGGTGCCTGGACAAAGGATCCACTGAAATTTGACAACTCCTATTTCATTGAGCTTCTGAAAGAGAATTCAGAAGGGCTT
CTGAAGTTGCCTACTGACAAGGCTCTTGTTGAAGATCCTACATTCCGCCGCTATGTCGAACTATATGCCAAG
GACGAAGATGCATTTTTCAGGGACTATGCAGAGTCGCACAAGAAGCTA
TCTGAGCTGGGGTTCACGCCTCCTCGCTCTGCATTCATCTACAAATCATGCCAGAAACCAAAGTCCCTGTTGATGCAAACTGCAGCTGGGGTTGCAGTTGCTGCTGCAGTTGTCGCATGG
GCTTACCTCTGTGAATCCAACAAGAGGCTTGGCTAA

Retrieve as FASTA