Entry information : SoPrx14 ( SOVF_065170)
Entry ID 187
Creation 2006-06-23 (Christophe Dunand)
Last sequence changes 2015-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-01-28 (Catherine Mathe)
Peroxidase information: SoPrx14 ( SOVF_065170)
Name (synonym) SoPrx14 ( SOVF_065170)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Amaranthaceae Spinacia
Organism Spinacia oleracea (spinach)    [TaxId: 3562 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SoPrx14
start..stop
S start..stop
BvPrx10 614 0 1..337 1..333
SoPrx16 607 0 1..337 1..334
SoPrx15 602 0 1..337 1..334
BvPrx58 597 0 1..337 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61696..61935 240 N° 2 62173..62364 192 N° 3 62692..63273 582  
join(61696..61935,62173..62364,62692..63273)


exon

Literature and cross-references SoPrx14 ( SOVF_065170)
Literature Diogon,T. and Simon,P. Cloning and characterization of peroxidase cDNAs in Spinacia oleracea
Protein ref. UniProtKB:   Q9M4Z3
DNA ref. GenBank:   AF244923   KQ141077.1 (61696..63273)
Protein sequence: SoPrx14 ( SOVF_065170)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (315)
PWM (Da):   %s   37126.8 (34629.5)  
PI (pH):   %s   9.41 (9.43) Peptide Signal:   %s   cut: 23 range:23-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKSMGYFILVALLALAPLCLSHKIHGGGGRGGYLHPQFYDHSCPQMHQIIKSVVAQAVSRDRRMAASLLRLHFHDCFVKGCDASLLLDNGGGIVSEKGSNPNRNSVRGFEVIDAIKAAVEKACPHTVSCADILAVVARDSTVIAGGPNWEVPLGRRDSRGASLSGSNNDIPAPNNTFNTILTKFKRQGLDLIDLVALSGAHTIGNARCVSFRQRLYNQNRNGQPDFTLDQVYASKLRNQCPRSGGDQNLFFLDYVSPFSFDNSYYRNILANKGLLNSDQVLLTKNHASMQLVKQYAENMELFFDHFSKSIVKMGNISPLTGMQGEIRQNCRRINAY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTAAGTCCATGGGCTACTTCATTTTGGTGGCTCTCCTAGCACTTGCCCCTCTATGCTTATCTCACAAAATACACGGTGGTGGTGGTCGAGGTGGCTATCTCCACCCTCAGTTCTAC
GACCACTCGTGCCCTCAAATGCATCAGATTATCAAGTCAGTTGTTGCTCAGGCGGTTTCAAGGGATCGTAGGATGGCTGCTTCCTTGCTTAGGCTTCATTTCCATGACTGCTTTGTTAAG
GTAAATACTACCTTCGTTTCATAATGATCTTTACACTTTATGTTTTAGTCTGTTTCATAACTTTTTTTTACATTGTGCTTTGTAATATATTTGGACATGAAAATGTACCACTTCACCCCT
CTTATATCACAAAATTTACATCTTTTCACTCACTTCGATCATTGGAGTACATGTTGATTTTTAGTCTAAACAATACTAATAAGTTAGCATTTGTTTGTGCATGATTCATTTTTGCAGGGA
TGTGATGCCTCATTGTTGCTAGACAATGGTGGAGGCATAGTCTCTGAGAAGGGGTCCAACCCTAACAGGAACTCAGTTCGAGGGTTTGAGGTCATTGATGCTATCAAGGCTGCAGTAGAG
AAAGCATGCCCTCATACTGTCTCTTGTGCTGATATCCTTGCTGTAGTTGCCAGAGATTCAACTGTCATT
GTAAGTATCTATTAGACTCCATTCTATTCACCTTATTTCCACTTATTTCAG
GGAAATTAAGTTCAGATAAGTTCAGGAAAAATAAGGGTTGACCAAGTACACTTTATAACTAAAATAAGTTCAGAACAATTCAGATAAAAACAACTGTCATTGTAATTATCTATTAGGCTT
TGTTCTCTTCATCTTATTTCCACTTGTTTCAGTAAAAACAAGTTCAGAAAAAAAAAAGGTTGACCTAGTACACTTTATAACTAAAATAAGTTATAACAAGTTCAAATAAGTTAAGATAAG
TTCAGGTAAGTTATAACTAATGCTGTTACACTGCAGGCTGGTGGACCGAACTGGGAGGTGCCCCTAGGAAGAAGGGATTCAAGAGGAGCAAGTTTGAGTGGATCAAACAATGACATTCCT
GCTCCAAACAACACTTTTAACACCATTCTTACCAAGTTCAAACGCCAAGGCCTCGATCTTATTGACCTTGTTGCCCTCTCAGGTGCTCACACAATAGGAAATGCAAGGTGTGTTAGTTTC
AGACAAAGGTTGTACAACCAGAACAGAAACGGGCAACCAGATTTCACACTTGACCAAGTTTATGCTTCTAAGTTGCGCAACCAGTGCCCGCGGTCAGGTGGTGACCAAAACCTGTTCTTT
TTAGACTATGTTTCCCCCTTCAGTTTTGACAACAGTTACTACAGAAACATATTGGCTAACAAAGGGTTACTGAATTCTGATCAAGTTTTATTAACCAAGAATCATGCTTCAATGCAATTA
GTGAAGCAATATGCTGAAAATATGGAGTTGTTTTTTGATCATTTTTCCAAGTCCATTGTTAAAATGGGTAATATTTCCCCATTGACAGGAATGCAGGGTGAAATCAGGCAAAACTGTAGG
AGGATTAATGCTTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTAAGTCCATGGGCTACTTCATTTTGGTGGCTCTCCTAGCACTTGCCCCTCTATGCTTATCTCACAAAATACACGGTGGTGGTGGTCGAGGTGGCTATCTCCACCCTCAGTTCTAC
GACCACTCGTGCCCTCAAATGCATCAGATTATCAAGTCAGTTGTTGCTCAGGCGGTTTCAAGGGATCGTAGGATGGCTGCTTCCTTGCTTAGGCTTCATTTCCATGACTGCTTTGTTAAG
GGATGTGATGCCTCATTGTTGCTAGACAATGGTGGAGGCATAGTCTCTGAGAAGGGGTCCAACCCTAACAGGAACTCAGTTCGAGGGTTTGAGGTCATTGATGCTATCAAGGCTGCAGTA
GAGAAAGCATGCCCTCATACTGTCTCTTGTGCTGATATCCTTGCTGTAGTTGCCAGAGATTCAACTGTCATT
GCTGGTGGACCGAACTGGGAGGTGCCCCTAGGAAGAAGGGATTCAAGA
GGAGCAAGTTTGAGTGGATCAAACAATGACATTCCTGCTCCAAACAACACTTTTAACACCATTCTTACCAAGTTCAAACGCCAAGGCCTCGATCTTATTGACCTTGTTGCCCTCTCAGGT
GCTCACACAATAGGAAATGCAAGGTGTGTTAGTTTCAGACAAAGGTTGTACAACCAGAACAGAAACGGGCAACCAGATTTCACACTTGACCAAGTTTATGCTTCTAAGTTGCGCAACCAG
TGCCCGCGGTCAGGTGGTGACCAAAACCTGTTCTTTTTAGACTATGTTTCCCCCTTCAGTTTTGACAACAGTTACTACAGAAACATATTGGCTAACAAAGGGTTACTGAATTCTGATCAA
GTTTTATTAACCAAGAATCATGCTTCAATGCAATTAGTGAAGCAATATGCTGAAAATATGGAGTTGTTTTTTGATCATTTTTCCAAGTCCATTGTTAAAATGGGTAATATTTCCCCATTG
ACAGGAATGCAGGGTGAAATCAGGCAAAACTGTAGGAGGATTAATGCTTACTAA

Retrieve as FASTA