Entry information : HaPrx21 (HanXRQChr10g0296231)
Entry ID 1877
Creation 2005-09-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx21 (HanXRQChr10g0296231)
Name (synonym) HaPrx21 (HanXRQChr10g0296231)
Class Class III peroxidase    [Orthogroup: Prx164]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx21
start..stop
S start..stop
HaPrx77 753 0 1..376 16..391
HaPrx[P]76 657 0 43..376 1..334
HaPrx13 555 0 78..376 36..331
HaPrx20 553 0 43..376 1..330
Gene structure Fichier Exons


exon

Literature and cross-references HaPrx21 (HanXRQChr10g0296231)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L.,
Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project
DNA ref. HanXRQ genome:   HanXRQChr10 (117674107..117672769)
EST ref. GenBank:   AJ540201.1 [3' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr10g0296231
Protein sequence: HaPrx21 (HanXRQChr10g0296231)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   376
PWM (Da):   %s   40399.71 Transmb domain:   %s   i9-31o
PI (pH):   %s   9.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVDFQSPTKTIYTDPPCNVSTSTSHLRNTLLNLKDKSLLLLLMEISSLSKTVALLVLLLATLTTLSLGQGNRGSGSGTRLGYYRSSCPRAESIVQSAVRPAVQANPTIAPGLLRMFFHDC
FVNGCDASILIDGPTTEKSAGPNSLLRGFEVIDAAKSQLETACPGVVSCADIVALAARDSVVLTGGRSWQVRLGRRDGLVSQASDTANLPAFNDPISVQIRKFADKGLNTQDLVTLVGGH
TIGTAACALFSYRLYNFNNTNGPDPDINPAFLPQLRALCPNGGDALRRVALDTGSDNSFGNSFYENLRNGRGVIESDAKLWSDRRTQRFVQRYLGGRGQIGSRFNAEFGRAMVKMGNIEV
KTGTQGEIRRVCTATN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
CDS
Send to BLAST