Entry information : SoPrx13 ( SOVF_065520)
Entry ID 188
Creation 2006-06-23 (Christophe Dunand)
Last sequence changes 2015-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-09 (Achraf Jemmat)
Peroxidase information: SoPrx13 ( SOVF_065520)
Name (synonym) SoPrx13 ( SOVF_065520)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Amaranthaceae Spinacia
Organism Spinacia oleracea (spinach)    [TaxId: 3562 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SoPrx13
start..stop
S start..stop
BvPrx07 584 0 7..329 19..341
CsPrx10 531 0 1..329 1..330
CclPrx35 531 0 1..329 1..330
LePrx67 529 0 5..330 6..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4084..4281 198 N° 2 3379..3544 166 N° 3 1697..2109 413  
complement(join(1697..2109,3379..3544,4084..4281))


exon

Literature and cross-references SoPrx13 ( SOVF_065520)
Literature Dohm,J.C. et al., the genome of the recently domesticated crop plant sugar beet (Be vulgaris. Nature 505 (7484), 546-549 (2014)
Protein ref. GenBank:   AAF63025.1 UniProtKB:   Q9M4Z4 [Mismatch]
DNA ref. GenBank:   KQ141200.1 (4388..1697) [3' end]
mRNA ref. GenBank:   AF244922.1 [Mismatch]
Protein sequence: SoPrx13 ( SOVF_065520)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (309)
PWM (Da):   %s   36146.44 (33884.2)  
PI (pH):   %s   8.78 (8.73) Peptide Signal:   %s   cut: 22 range:22-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANKSLFLSLLILAISPLCFSEKSQGGNLYPQFYDHSCPKLEDIVWSVLAKVVAKEPRMAASLLRLHFHDCFVKGCDGGVLLDSSGSIVSEKRSNPNRNSARGFEVIDEIKAAVEKACPETVSCADILALTARDSTLLVGGPNWEVPLGRRDSLDASLSGSNYNIPAPNNTFQTILTKFKLKGLDLVDLVALSGSHTIGDARCTSFRQRLYNQSGNGQPDKTLNPAMAAVLRNRCPRSGGDQNLFNLDHVTPFKFDNSYYKNLLANKGLLSSDEILVSQNADSMKLVKQYAENNHLFFQHFAQSMVKMGNIAPLTGSRGEIRRVCRRVNH

Retrieve as FASTA  
Remarks Complete sequence from 1 mRNA and genomic (exon 1 is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGGTTGTGATGGTGGGGTTCTACTAGACAGCAGTGGTTCTATAGTAAGCGAGAAGAGGTCGAACCCAAACAGGAATTCGGCTCGAGGGTTCGAGGTCATTGATGAGATCAAGGCT
GCAGTGGAGAAAGCATGCCCTGAGACTGTGTCTTGTGCTGATATCTTGGCTTTAACTGCTAGAGACTCTACTCTTCTT
GTATGTTTCACATGTGTATTCATCATCATTATCATTATTGTA
GACGATAAATTTAGTCGGAAAAACTCCGTTTTCTTGTAGACGTCATTATCATTATCCTAGAGGTAATCAAAATTCATGTCATGTCGGGCCGGGTTGGGATTTAACACAAAAATTCATGCC
CACACCCATAAATTTGGTGTGGATTTTTTGACCACAACGTGTTTTTTCGGGCCGGGCTTTGGACTAAATGCTTATTTGAGACTACACAAACTTACACTTTGTTCAAGCTGGGCCAAGTTG
GTCCAGCGGGCCGGGCTATAGTTAATGAGGTATACATTATCCCATTGCCTTCTCATAGGCTCCAGTAGCAAGCGGGAGTAAGGGTAGGTCGGATTTACGCCGCAACCTTACCCCCGCAAT
TGTAGAGAGGTTGTTTTCAATTGATTCATATATAATTTCGCATGTGGATCTTAAGATTTTTTTAAAATCATATAATACTTACATACATGTAAATCATTGTTTTTTAAGTTAATGGTGTTC
ATATTTGTATGTTGCAGGTTGGAGGACCAAACTGGGAGGTACCACTAGGGAGAAGGGACTCTCTAGATGCTAGTTTGAGTGGCTCAAACTACAACATTCCTGCTCCTAACAACACATTTC
AAACCATTCTTACCAAATTCAAGCTTAAGGGGCTTGATCTAGTTGACCTTGTCGCGCTTTCTG
GTATGTGGATTGTTTTTTTATGAAATTTCACCACGTTTTAAGAAAAAATAACAAATA
TCTTTCGAGTTTTAAAAAATTCACCAAATACTCCTGGTATTCAATAAGATTTCCCTTAATAACGTCATTAACCCTATAATTAGCTTAAAAGGCTTGATCTTATCGACTGATTTTATTTTA
TATGTTTCATTTGGCTCTATCATTACTCATTAGCTGTCTGGAACTAGAAAAGGTGACATTGACATAAAATCAAATTCCAATCTTGCAAAGGGAAAGAAATTCTTCCTTTTGAAAAAGTTG
TCTCACAAGTAGTGAACTGTGGTGCTAATAGAGAAATAATTGTCTTAAAAGGAGGTTAAGATGCTCATATTATTGTATACCACCTCTTGATTTATACTTTATGAGTTTATGCAATGTTTA
ACAAGAAGCTAATTGGGAATGTTACGTTTATCAATAAGTTAAACCAAATTTCATAAAGGGGTAAGCGCGAGCATGGAGAGAACAAAAGGTATTGCACACATTGGTGTACAATAAATCTAT
TAATGGGGTAACTGTTTATCCATCTTTTGGTAAATTTTAACATATTTTAATTAACTTGAAGTATATTGAAAAAAAAAATTGATAGATAAACATTTTAATGGACATATAGTTACTTCTATA
CATTATTAGTGATTTTAAAAGGATAATTCTTATCAAAACGAAAAATTTACCAGTAAAAAAAAAAAAAATTACATTATATTTGGGGACAATTTTTAAACACTTCGACTAAACTTTTACTCA
GATGTTGATATTTATTATACTCTACTTTTAAATAACTATTTGTGTAGATAATTTTAAGCATGCCATTTCACTTCATGTTTATTAGATGTCTTATGGTATTATAAATAGTTGACTCTATGT
ACCAACATCAATAACCATTTCACTTCATGTTAAGATGTCTTATGGTGTTATAAATAGTTGATTATGTACCAACAAGTATAACCAACATACTCAGTGTGTAATTTGAAGTTCGAGCCCCAT
CAACTGCAATATGTTTGAGCTGAGAGTGGTTCAAGCATTGACTTGTATAATTGGGCTGACTAATATCAGATACATACTGGTTTAACAGGGAAATGAAGACAGATCATTATGGACTTAGTT
TCTTAATTCTTACCTCCCCTTGTCGATCCTAATAGAGTATAAAACTAATCTTGAGACTTCAACCATCAGCTTAAGTTTTTGGTTAAGTTGGTCATTTGATAGTGACACTGCTAATGCATT
GTAATACTGCAGGGAGTCACACAATAGGGGATGCAAGGTGCACAAGCTTCAGGCAAAGGCTATACAACCAGAGCGGAAACGGACAACCCGACAAAACCCTAAACCCGGCCATGGCAGCTG
TGTTGCGCAACCGTTGCCCACGGTCTGGTGGTGACCAGAACTTGTTTAACTTAGACCATGTTACCCCTTTCAAGTTTGACAACAGTTACTACAAGAACTTGCTGGCTAACAAGGGCCTTT
TGAGTTCTGATGAAATTCTGGTGTCCCAAAATGCAGATTCTATGAAACTAGTGAAACAATATGCAGAGAACAATCATCTTTTCTTCCAACATTTTGCACAATCCATGGTTAAGATGGGAA
ACATTGCTCCATTGACTGGTTCAAGGGGTGAAATCAGAAGAGTTTGCAGAAGAGTTAATCACTAA

Retrieve as FASTA