Entry information : HaPrx18 ( HanXRQChr08g0222541)
Entry ID 1880
Creation 2005-09-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx18 ( HanXRQChr08g0222541)
Name (synonym) HaPrx18 ( HanXRQChr08g0222541)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx18
start..stop
S start..stop
LperPrx33 585 0 8..325 4..321
NtPrx11-1A 518 0 13..325 9..321
NtPrx11-1B 514 0 13..325 9..321
CiPrx04 508 0 59..325 1..267
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 55578528..55578752 225 N° 2 55579312..55579503 192 N° 3 55579613..55579778 166 N° 4 55580200..55580594 395
join(55578528..55578752,55579312..55579503,55579613..55579778,55580200..55580594 )


exon

Literature and cross-references HaPrx18 ( HanXRQChr08g0222541)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L.,Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project
DNA ref. HanXRQ genome:   HanXRQChr08 (55578528..55580594)
EST ref. GenBank:   GE507029.1 [5' end]   AJ541430.1 [3' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr08g0222541
Protein sequence: HaPrx18 ( HanXRQChr08g0222541)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (297)
PWM (Da):   %s   34540.14 (31597.7) Transmb domain:   %s   i12-34o
PI (pH):   %s   9.51 (9.35) Peptide Signal:   %s   cut: 29 range:29-325
Sequence 366
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFSSSSSSSSVLLKYALVMFFMGVVSAQLSTNFYSSSCPKLLPTVRSAVQSAISKETRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKRAAPNFRSARGFEVVDNIKSAVESVCPGVVSCADILAISARDSVHILGGPTWGVKLGRRDSRTASQAAANNSIPPPTSSLSALISSFRAVGLSAKDMVALSGSHTIGQARCTNFRARIYNETNNLDASFATQRRSNCPRATGSGDNNLAPLDVQSPNAFNNDYYKNLINQKGLLHSDQQLFNGGSADSTVRQYSSNPGQFSADFAAAMIKMGDNKPLTGSSGEIRKNCRRPN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGTTCTCTTCTTCTTCTTCTTCTTCTTCAGTTCTACTGAAGTATGCACTTGTTATGTTTTTTATGGGAGTTGTTTCGGCTCAACTTTCAACTAACTTTTACTCGAGCTCTTGCCCAA
AACTTCTCCCGACTGTAAGATCAGCCGTGCAATCGGCTATTTCAAAAGAAACTCGGATGGGAGCTTCTCTCCTTCGGTTGCACTTCCATGATTGCTTTGTCAAT
GTATATTTCTTTATTT
GTTTTCTCATCCTTTTAGACTTTCTTTCAAATTTCTGAGCACACATGCGCGTACACACACAAAGCGCGGCGTGTTTGTCTATATTTACATATATAGGCATGGTCAATACACATCATATGT
GTCTATATATACATATTTAGGCATGGTAATTACACATTAGTTGTGGTGAGACAAAAAAAAAATGAGAGATATAGTCATATAACACCATAATGGAATGAATGAATTTTTTGGGAAGCAAAT
AGCCATTTCCATTTTTTACTTTAGAATATTTATGTTAACGTCAACACACATATTAAATAAAATCACCAAGAGTATCAATAGGCAAGAATGAACCAACATTTAGTACTAGTTTTCTAGAAA
ATCATCATTAAGATATTCAAATATGCTACATGGTGACAACTAGTAAAGTCAAACTTAACTAATATGATTAATTATATCGTAATCATGTAGTAACGAGGCTTTTAAGAAAAAATGTTTCAA
GTTTACATATATTTTATTTTAACTTTTGTTAACTATACTTACCAACATATCATTTTCGATCAGGGATGTGACGGTTCGATCCTTCTTGATGATACATCCTCCTTCACCGGTGAAAAGCGT
GCAGCTCCTAACTTTAGATCCGCTAGAGGGTTTGAAGTGGTGGACAATATAAAGTCGGCTGTCGAAAGTGTATGCCCTGGTGTGGTCTCGTGTGCTGATATACTCGCTATTAGCGCTAGA
GACTCCGTTCATATT
GTAAGTTTCTTTTCTTATCATGTTAGTGTTTGGATTGAAAGTTAATCTAGCTACTAACCATCAAAATTAAGGTTTCAAAAGAAATGCTAACCTAGTGTTTATAAT
GAAGCTTGGTGGACCTACTTGGGGTGTTAAATTGGGAAGGCGCGACTCAAGGACCGCAAGCCAGGCTGCAGCCAACAACAGCATTCCTCCACCCACATCGAGCCTCAGTGCACTCATCTC
TTCTTTTAGGGCCGTTGGTCTTTCGGCTAAGGACATGGTGGCTCTATCAG
GTCAACATCCCCCCCCCCCCCTCTTGACTTTAAAACTAGTTAATTTTTTAAAATGTTTTATGTCAAAAAG
TAAATTAGAATATTTTTTGTCAAATAAAAAAGAAACAAATGTCAACAACCATCAACTTAAATCATTTTATCCACTCTTCTCGCAACCGGACTTGTTTGGTTGAGCCTTCTTAAATCATCT
TCATTTGAACCGGTCACTTACAGGTTGAACCAGAGGAATTGGCGAACCAAACAATGGTTGGGCTTGATTTAAATAAACATTTTCATATTTTATTTTTTTAAAATCAGTTATATAACCGGT
CTGTCCGGTGGATCGATAAGATGACCAGTTCAGTGACCGCTTTGACCGAGTATAAAAAGATTAAATTTTAAATATTGACCGATTGATATACTATCTTGGAAACGAAAACAGGTTCCCACA
CAATCGGGCAGGCACGGTGCACCAACTTCCGAGCCCGAATCTACAACGAAACCAACAATTTGGATGCTTCTTTCGCTACACAAAGGCGGTCCAACTGCCCGAGAGCCACGGGCTCTGGTG
ACAACAATTTGGCACCACTTGATGTCCAGTCTCCAAACGCTTTCAACAATGACTATTACAAGAACTTGATCAACCAAAAGGGGTTGCTCCACTCTGATCAACAACTGTTCAATGGCGGTT
CGGCTGATTCAACCGTCAGACAATATAGCAGCAACCCCGGTCAATTCAGTGCCGATTTTGCCGCAGCCATGATCAAGATGGGTGATAACAAGCCACTAACTGGATCCAGTGGAGAGATCA
GGAAGAATTGCAGGAGGCCCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGTTCTCTTCTTCTTCTTCTTCTTCTTCAGTTCTACTGAAGTATGCACTTGTTATGTTTTTTATGGGAGTTGTTTCGGCTCAACTTTCAACTAACTTTTACTCGAGCTCTTGCCCAA
AACTTCTCCCGACTGTAAGATCAGCCGTGCAATCGGCTATTTCAAAAGAAACTCGGATGGGAGCTTCTCTCCTTCGGTTGCACTTCCATGATTGCTTTGTCAAT
GGATGTGACGGTTCGA
TCCTTCTTGATGATACATCCTCCTTCACCGGTGAAAAGCGTGCAGCTCCTAACTTTAGATCCGCTAGAGGGTTTGAAGTGGTGGACAATATAAAGTCGGCTGTCGAAAGTGTATGCCCTG
GTGTGGTCTCGTGTGCTGATATACTCGCTATTAGCGCTAGAGACTCCGTTCATATT
CTTGGTGGACCTACTTGGGGTGTTAAATTGGGAAGGCGCGACTCAAGGACCGCAAGCCAGGCTG
CAGCCAACAACAGCATTCCTCCACCCACATCGAGCCTCAGTGCACTCATCTCTTCTTTTAGGGCCGTTGGTCTTTCGGCTAAGGACATGGTGGCTCTATCAG
GTTCCCACACAATCGGGC
AGGCACGGTGCACCAACTTCCGAGCCCGAATCTACAACGAAACCAACAATTTGGATGCTTCTTTCGCTACACAAAGGCGGTCCAACTGCCCGAGAGCCACGGGCTCTGGTGACAACAATT
TGGCACCACTTGATGTCCAGTCTCCAAACGCTTTCAACAATGACTATTACAAGAACTTGATCAACCAAAAGGGGTTGCTCCACTCTGATCAACAACTGTTCAATGGCGGTTCGGCTGATT
CAACCGTCAGACAATATAGCAGCAACCCCGGTCAATTCAGTGCCGATTTTGCCGCAGCCATGATCAAGATGGGTGATAACAAGCCACTAACTGGATCCAGTGGAGAGATCAGGAAGAATT
GCAGGAGGCCCAATTAA

Retrieve as FASTA