1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx33 (At3g49110 / Athprxca / prxCa / AtPCa)
Entry ID 199
Creation 2006-06-16 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: AtPrx33 (At3g49110 / Athprxca / prxCa / AtPCa)
Name (synonym) AtPrx33 (At3g49110 / Athprxca / prxCa / AtPCa)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Cell wall
Tissue types Mixed tissues
Roots
Rosettes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx33
start..stop		 S start..stop
AlyPrx33 684 0 1..354 1..349
AhalPrx39 673 0 13..354 14..355
CrubPrx107 667 0 13..354 12..353
AtPrx34 661 0 13..354 12..353
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx33 (At3g49110 / Athprxca / prxCa / AtPCa)
Literature Intapruk,C., Yamamoto,K., Fujiyama,K., Takano,M. and Shinmyo,A. Cloning of cDNAs encoding two peroxidases of Arabidopsis thaliana and their organ-specific expression. J.Ferment.Bioeng. 75 (3), 166-172 (1993)
REFERENCE 2 Sundaravelpandian K, Chandrika NN, Schmidt W.
. PFT1, a transcriptional Mediator complex subunit, controls root hair differentiation through reactive oxygen species (ROS) distribution in Arabidopsis. New Phytol. 2013 Jan;197(1):151-61.
Protein ref. UniProtKB:   P24101
DNA ref. Phytozome 12:   Chr3 (18200713..18202891)
mRNA ref. GenBank:   NM_114770
Cluster/Prediction ref. Phytozome Gene 12:   19664624 UniGene:   At.23913
Omic ref. AtProteome:   At3g49110 ATTED-II:   At3g49110 e-FP Browser:   At3g49110 ePlant:   At3g49110 Genevestigator:   At3g49110 TAIR:   At3g49110
Protein sequence: AtPrx33 (At3g49110 / Athprxca / prxCa / AtPCa)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (323)
PWM (Da):   %s   38785.41 (35470.9) Transmb domain:   %s   i13-35o
PI (pH):   %s   6.86 (7.31) Peptide Signal:   %s   cut: 32 range:32-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQFSSSSITSFTWTVLITVGCLMLCASFSDAQLTPTFYDTSCPTV
TNIVRDTIVNELRSDPRIAGSILRLHFHDCFVNGCDASILLDNTTSFRTEKDALGNANSARGFPVIDRMKAAVERACPRTVSCADMLTIAAQQSVTLAGGPSWKVPLGRRDSLQAFLDLANANLPAPFFTLPQLKANFKNVGLDRPSDLVALSGAHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGQCPRNGNQSVLVDFDLRTPLVFDNKYYVNLKEQKGLIQSDQELFSSPNATDTIPLVRAYADGTQTFFNAFVEAMNRMGNI
TPTTGTQGQIRLNCRVVNSNSLLHDVVDIVDFVSSM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns), 3 cDNA and 7 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST