Entry information : SiAPx01 (Si037167m)
Entry ID 1993
Creation 2008-06-25 (Christophe Dunand)
Last sequence changes 2011-07-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiAPx01 (Si037167m)
Name (synonym) SiAPx01 (Si037167m)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value SiAPx01
start..stop
S start..stop
PamAPx01 505 0 1..250 1..250
SbAPx01 491 4.31e-179 1..250 1..250
ZmAPx05 487 1.21e-177 1..250 1..250
ZmAPx01 486 1.88e-177 1..250 1..250
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1993' 'complement(join(49453628..49453643,49453721..49453779,49453851..49453953,49454081..49454160,49454244..49454329,49454485..49454533,49455609..49455674,49455775..49455949,49456069..49456187))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49456069..49456187 117 N° 2 49455775..49455949 173 N° 3 49455609..49455674 64 N° 4 49454485..49454533 47
N° 5 49454244..49454329 84 N° 6 49454081..49454160 78 N° 7 49453851..49453953 101 N° 8 49453721..49453779 57
N° 9 49453628..49453643 14  
complement(join(49453628..49453643,49453721..49453779,49453851..49453953,4945408 1..49454160,49454244..49454329,49454485..49454533,49455609..49455674,49455775..4 9455949,49456069..49456187))


exon

Literature and cross-references SiAPx01 (Si037167m)
Literature Zhang,J.P., Liu,T.S., Fu,J.J., Zhu,Y., Jia,J.J., Zheng,J., Zhao,Y., Zhang,Y. and Wang,G.Y. Construction and application of EST library from Setaria italica in response to dehydration stress. Genomics 90 (1), 121-131 (2007).
DNA ref. Phytozome 12:   scaffold_9 (49456187..49453628)
EST ref. GenBank:   EC612205 [Fragment]
Protein sequence: SiAPx01 (Si037167m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27311.83  
PI (pH):   %s   5.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKCYPTVSAEYQEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSTKTGGPFGTMKNPAEQAHGANAGLDIAVRMLEPVKEEFPILSYADLYQLAGVVAVEVTGGPEIPFHPGRE
DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTRNPLVFDNSYFKELVSGDKEGLLQLPSDKALLSDPAFRPLVEKYAADEKAFFDDYKEAHL
KLSELGFADA*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGTGCTACCCGACCGTCAGCGCTGAGTACCAGGAGGCCGTCGAGAAGGCCAGGCGCAAGCTCCGCGCCCTCATCGCCGAGAAGAGCTGCGCCCCCCTCATGCTCCGTCTCGCG
TAAGCCCCGNNNNNNNNNNNNNNNNNNNNNNNNTCCGCTACCTAACCCCGCGCGTGCTTCCGGATCGTCGGCAGTAGTTTTCGGTGGCCTGATCTGGGCTTTCGATTTGGTTGCGCAGGT

GTGGCACTCGGCGGGGACGTTCGACGTGTCGACGAAGACCGGCGGCCCCTTCGGTACGATGAAGAACCCGGCGGAGCAGGCGCACGGCGCCAACGCGGGCCTGGACATCGCGGTGCGGAT
GCTCGAGCCCGTGAAGGAGGAGTTCCCCATCCTCTCGTACGCCGATCTGTACCAG
GTGCGCCCGCGATCTCGCAGCGATCTGGTCGGACGCTTCGATCCGCCCCTAAATGAATGCGGTTT
CTGACGGTTTTTTTGTTCTCTGTTTTGGTGCGTAGCTCTTGCGGGAGTTGTGGCCGTGGAGGTGACCGGTGGACCTGAGATCCCCTTCCACCCCGGTAGGGAGGTGAGACTTTTCATCCC
TTTTCTACTGCCTTTGGGGTTTTACCTGGGTTTAAGGCCTTGATTCGAAATGTCCAAGGAGGAGAGTGGGAAAGGTAGTATGGTGAGATCCTGGTTGTTTACTCCAATTAGTGCCACCGA
TTTATGAGCGTATTATCATGGGTTTGGTGGGTGCCTCTTATAGACAACCATATCCATTTATTCATGGCACGTGATCTTATAATTTAGTCTTCACATCGGTTTGTTTGAGGTTGGGGCCCA
TGTCTTGCTCTTGACAATAATTTTGTCTTATTGCGCTATGGGTTCATTGTTTGCGTGATATGTCTGGTAACGAAATGGTCGGCCTCTGTGATGTCAAAGTAACATAGTAATTTACTGTAA
TGTCTGTCCATATATGATATGCAGCTTTCAGTCTGTGCATAGGATTGAAGTTTGTTAATTGTTTGTTTGTACTGATTCATTCCTTGGTTCCTGTTGCATGTGATTGTTGAGTCACACAAA
TGGACCTTATGCATGTTTCATACTTTGTACTATGAGATGTCGCGACTAATCACTTGTCATCAACTTATATGTTACCTAAGATACTGGGTCTAACTTAATCTGTCTCTTTTGTGCTGGTTT
TGCAAATAGAGAATGACAAGAATACTAGATAGCCTTCCTTCTGAATATTAGTGTTGGAATGCTGGATTTATCTTGGGAAAAATCTATTGTTTATCATTTTGTATTCGTTTCATCCATCGG
CAAGCCATGCTCAGCTTTTTATGATATATATTCAATACAACAGGGGCGGAGCCAGTGGAGGCCAAACTGGGCTCCAGGCCCCCCTTGCTGATTCTCTTTTTTGTTTATAGTTGAGCATAC
TCTCTTGTGATTAGGCTGATGTACAGCAAAATATTGATACCACCAGACCATTAACTCTCTTGCATAGTGTCAGGTGTCAGTGAACATTTGATGATAACATTGCTCTATGAGACTCTGACA
GTGTTAGTTGTGATAGTCTTATTTGTTCGATGTTTTTTGGGTCATGACAGTGTTTGCTAATGCTCAGTGTATTTACATCTTTCCTTTGTCCTTTTCAGGAGACAAGCCTCAGCCGCCACC
TGAGGGCCGCCTTCCTGATGCTACTAAGG
GTAGGCCTCTAATCTTTAATACTATTGCCATGAATGTTGAACTGTTTGGTTGTATTCATCATTCTTCCTTGGGGGCTTTGGTGTCGTGTTG
AATCTCATTTTTAAATTGACACAAGAACCATCACTTACAGCTTGCTTGCTGTCTTCTTACCCAGGTGTTCTGACCATCTGAGGCAGGTCTTTGGCAAGCAGATGGGCTTGAGTGATCAGG
ACATTGTTGCCCTCTCTGGTGGCCACACCTTG
GTTTGTTGCTGTCCACTCATGTTTGCTTCATCATTGTGTAATATGTATGCATGCATTGATGTTGTTTTCTTGTTTTTCTTTAGGGGGA
AGGTGCCACAAGGAGCGGTCTGGTTTTGAGGGGGCCTGGACTAGAAACCCTTTGGTCTTTGACAACTCTTACTTCAA
GTGAGTCTACAGCTTGTTTAAAAAAGGAATTGGAATTAATTAA
GTGATGTTTGTAACTACCTTTGTTATCTCATTCTAGGCAGTTGAATGTTATTAGACACTAATAAGCCATCCGATATTTCTGTAGGGGGAACTTGTGAGTGGTGACAAGGAGGGCCTTCTT
CAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGCCTTCCGCCCTCTTGTGGAGAAATATGCTGCG
GTATGCCTCCAGTTCAATGCATCCAGAGTTTGGAGATATGTAAGAGATGCT
AATTGTTGATTGCGTTACAGGAGATGAGAAGGCTTTCTTTGATGACTACAAGGAGGCCCACCTCAAGCTCTCTGAACTGGGGTGAGTAACCATTGCCCACTCAATTTTGTGCTTAAGTCG
TTGGAACAAATCTGATTGTTTTCCTTTGTGGATTGCAGGTGTTCGCCGATGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGTGCTACCCGACCGTCAGCGCTGAGTACCAGGAGGCCGTCGAGAAGGCCAGGCGCAAGCTCCGCGCCCTCATCGCCGAGAAGAGCTGCGCCCCCCTCATGCTCCGTCTCGCG
TGGCACTCGGCGGGGACGTTCGACGTGTCGACGAAGACCGGCGGCCCCTTCGGTACGATGAAGAACCCGGCGGAGCAGGCGCACGGCGCCAACGCGGGCCTGGACATCGCGGTGCGGATG
CTCGAGCCCGTGAAGGAGGAGTTCCCCATCCTCTCGTACGCCGATCTGTACCAG
CTTGCGGGAGTTGTGGCCGTGGAGGTGACCGGTGGACCTGAGATCCCCTTCCACCCCGGTAGGGAG
GACAAGCCTCAGCCGCCACCTGAGGGCCGCCTTCCTGATGCTACTAAGGGTTCTGACCATCTGAGGCAGGTCTTTGGCAAGCAGATGGGCTTGAGTGATCAGGACATTGTTGCCCTCTCT
GGTGGCCACACCTTG
GGAAGGTGCCACAAGGAGCGGTCTGGTTTTGAGGGGGCCTGGACTAGAAACCCTTTGGTCTTTGACAACTCTTACTTCAAGGAACTTGTGAGTGGTGACAAGGAG
GGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGCCTTCCGCCCTCTTGTGGAGAAATATGCTGCG
GATGAGAAGGCTTTCTTTGATGACTACAAGGAGGCCCACCTC
AAGCTCTCTGAACTGGG
GTTCGCCGATGCATAA

Retrieve as FASTA