Entry information : CsaPrx01 (Cucsa.153420.1 / CUSPREPERA)
Entry ID 20
Creation 2006-03-23 (Christophe Dunand)
Last sequence changes 2011-06-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx01 (Cucsa.153420.1 / CUSPREPERA)
Name (synonym) CsaPrx01 (Cucsa.153420.1 / CUSPREPERA)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx01
start..stop
S start..stop
CpPrx01 538 0 18..329 14..325
CmPrx01 504 0 1..270 1..270
CsaPrx03 473 1e-169 5..329 7..338
CmPrx02 459 6e-164 5..318 13..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 539055..539255 201 N° 2 538792..538980 189 N° 3 538095..538694 600  
complement(join(538095..538694,538792..538980,539055..539255))


exon

Literature and cross-references CsaPrx01 (Cucsa.153420.1 / CUSPREPERA)
Literature Rasmussen,J.B., Smith,J.A., Williams,S., Burkhart,W., Ward,E.R., Somerville,S.C., Ryals,J. and Hammerschmidt,R.1992 unpublished.
Protein ref. UniProtKB:   Q39653 [3' end]
DNA ref. Phytozome 12:   scaffold01124 (539255..538095)
mRNA ref. GenBank:   M91374 [3' end]
Protein sequence: CsaPrx01 (Cucsa.153420.1 / CUSPREPERA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (309)
PWM (Da):   %s   36446.31 (34034.2)  
PI (pH):   %s   6.66 (6.66) Peptide Signal:   %s   cut: 21 range:21-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSFSFFLSFLCVFFVTSYAQLTENFYDQTCPRLPNIVRREVKRAIETDIRAGAKLIRFHFHDCFVQGCDGSVLLEDPPGFETELNGLGNLGIQGIEIIDAIKAAVEIECPGVVSCADILAQASKDSVDVQGGPSWRVLYGRRDSRTANKTGADNLPSPFENLDPLVKKFADVGLNETDLVALSGAHTFGRSRCVFFSGRLSNFSGSGQPDPTLDPTYRQELLSACTSQDTRVNFDPTTPDKFDKNYFTNLRANKGLLQSDQVLHSTQGAKTVEIVRLMALKQETFFRQFRLSMIKMGNIKPLTGSQGEIRRNCRRVNDLGSETGHDVM*

Retrieve as FASTA  
Remarks Complete sequence from genomic, 1 cDNA and 3 ESTs (CO998379, CO997890,CO995819).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCTTCAGTTTCTTCCTTTCGTTTCTTTGTGTTTTCTTTGTAACCTCTTATGCCCAACTCACTGAGAATTTCTACGACCAAACTTGCCCTCGTCTCCCTAACATTGTCCGCCGT
GAAGTCAAAAGAGCTATCGAAACTGATATTCGTGCTGGTGCTAAACTCATTCGCTTCCATTTCCACGATTGTTTCGTCCAA
GTAACTATTCTTCCTTACTTCATTTACTTCCCTTTCCTA
TGCCATATGTTTTTACAATGGGGTTCATTTTGTAGGGCTGCGATGGGTCTGTTTTGCTAGAGGATCCTCCTGGCTTCGAGACCGAGCTCAACGGACTTGGAAACTTAGGAATCCAAGGAA
TCGAGATTATCGACGCTATCAAAGCTGCCGTCGAGATAGAATGCCCTGGCGTTGTCTCCTGTGCCGACATCCTAGCTCAAGCCTCTAAGGACTCTGTCGACGTG
GTAATCATCATTCCCC
CCCATTTCAATCTTCAAAATCAACAATAAAAAAAAAGTACACTAATATTTGGGATTTTCTTTTCTGTGTTTGGTGAATCAGCAAGGAGGACCCAGTTGGAGAGTTCTATACGGAAGAAGA
GATAGCAGAACAGCCAATAAAACAGGGGCTGATAACCTCCCAAGCCCCTTCGAAAATCTTGACCCACTCGTAAAAAAATTTGCAGACGTTGGTTTAAATGAAACCGACCTTGTTGCTCTA
TCAGGGGCACATACGTTTGGTCGGTCCAGATGCGTGTTCTTCAGTGGTCGTTTGTCCAACTTCAGTGGCAGTGGGCAACCAGATCCAACGCTGGATCCAACTTACAGGCAAGAACTTCTA
AGCGCTTGTACAAGCCAAGACACACGAGTGAATTTCGATCCAACAACACCTGATAAATTTGATAAGAATTACTTCACCAATCTTCGAGCCAATAAAGGGCTGTTACAGAGTGACCAAGTT
CTGCATTCAACGCAAGGGGCTAAAACAGTTGAAATTGTTAGACTTATGGCGTTGAAACAAGAAACTTTCTTTAGACAATTTCGGTTGTCGATGATTAAGATGGGGAACATTAAACCATTA
ACTGGAAGCCAAGGGGAAATTAGAAGAAACTGCAGGAGGGTTAATGACTTGGGAAGTGAAACAGGGCATGATGTTATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCTTCAGTTTCTTCCTTTCGTTTCTTTGTGTTTTCTTTGTAACCTCTTATGCCCAACTCACTGAGAATTTCTACGACCAAACTTGCCCTCGTCTCCCTAACATTGTCCGCCGT
GAAGTCAAAAGAGCTATCGAAACTGATATTCGTGCTGGTGCTAAACTCATTCGCTTCCATTTCCACGATTGTTTCGTCCAA
GGCTGCGATGGGTCTGTTTTGCTAGAGGATCCTCCTGGC
TTCGAGACCGAGCTCAACGGACTTGGAAACTTAGGAATCCAAGGAATCGAGATTATCGACGCTATCAAAGCTGCCGTCGAGATAGAATGCCCTGGCGTTGTCTCCTGTGCCGACATCCTA
GCTCAAGCCTCTAAGGACTCTGTCGACGTG
CAAGGAGGACCCAGTTGGAGAGTTCTATACGGAAGAAGAGATAGCAGAACAGCCAATAAAACAGGGGCTGATAACCTCCCAAGCCCCTTC
GAAAATCTTGACCCACTCGTAAAAAAATTTGCAGACGTTGGTTTAAATGAAACCGACCTTGTTGCTCTATCAGGGGCACATACGTTTGGTCGGTCCAGATGCGTGTTCTTCAGTGGTCGT
TTGTCCAACTTCAGTGGCAGTGGGCAACCAGATCCAACGCTGGATCCAACTTACAGGCAAGAACTTCTAAGCGCTTGTACAAGCCAAGACACACGAGTGAATTTCGATCCAACAACACCT
GATAAATTTGATAAGAATTACTTCACCAATCTTCGAGCCAATAAAGGGCTGTTACAGAGTGACCAAGTTCTGCATTCAACGCAAGGGGCTAAAACAGTTGAAATTGTTAGACTTATGGCG
TTGAAACAAGAAACTTTCTTTAGACAATTTCGGTTGTCGATGATTAAGATGGGGAACATTAAACCATTAACTGGAAGCCAAGGGGAAATTAGAAGAAACTGCAGGAGGGTTAATGACTTG
GGAAGTGAAACAGGGCATGATGTTATGTAA

Retrieve as FASTA