1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx38 (At4g08780 / PER38 / AtperoxP38)
Entry ID 204
Creation 2006-07-27 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: AtPrx38 (At4g08780 / PER38 / AtperoxP38)
Name (synonym) AtPrx38 (At4g08780 / PER38 / AtperoxP38)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx38
start..stop		 S start..stop
AlyPrx38-1 667 0 1..346 1..346
AhalPrx37 664 0 1..346 1..346
AhalPrx27 655 0 1..346 1..346
AtPrx37 645 0 1..346 1..346
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx38 (At4g08780 / PER38 / AtperoxP38)
Protein ref. UniProtKB:   Q9LDA4
DNA ref. Phytozome 12:   Chr4 (5604153..5608202)
mRNA ref. GenBank:   NM_116948
Cluster/Prediction ref. Phytozome Gene 12:   19645617
Omic ref. AtProteome:   At4g08780 ATTED-II:   At4g08780 e-FP Browser:   At4g08780 ePlant:   At4g08780 Genevestigator:   At4g08780 TAIR:   At4g08780
Protein sequence: AtPrx38 (At4g08780 / PER38 / AtperoxP38)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (324)
PWM (Da):   %s   37930.29 (35528.9)  
PI (pH):   %s   7.72 (7.24) Peptide Signal:   %s   cut: 23 range:23-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHSSLIKLGFLLLLLQVSLSHAQLSPSFYDKTCPQVFDIVTNTIV
NALRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFDVIDKMKAAIEKACPRTVSCADMLAIAAKESIVLAGGPSWMVPNGRRDSLRGFMDLANDNLPGPSSTLKQLKDRFKNVGLDRSSDLVALSGGHTFGKSQCQFIMDRLYNFGETGLPDPTLDKSYLATLRKQCPRNGNQSVLVDFDLRTPTLFDNKYYVNLKENKGLIQSDQELFSSPDAADTLPLVRAYADGQGTFFDAFVKAIIRMSSL
SPLTGKQGEIRLNCRVVNSKSKIMDVVDDALEFASFM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 3 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST