1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Entry ID 209
Creation 2006-06-15 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-03-30 (Catherine Mathe)
Peroxidase information: AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Name (synonym) AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Endoderm
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx43
start..stop		 S start..stop
AlyPrx43 627 0 1..326 1..326
CagraPrx52 625 0 1..326 1..326
AhalPrx42 624 0 1..326 45..370
BstrPrx30 614 0 1..326 1..326
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Protein ref. UniProtKB:   Q9SZH2
DNA ref. Phytozome 12:   Chr4 (13189528..13191507)
mRNA ref. GenBank:   NM_118731
Cluster/Prediction ref. Phytozome Gene 12:   19643742 UniGene:   At.50365
Omic ref. AtProteome:   At4g25980 ATTED-II:   At4g25980 e-FP Browser:   At4g25980 ePlant:   At4g25980 Genevestigator:   At4g25980 TAIR:   At4g25980
Protein sequence: AtPrx43 ( At4g25980 / PER43 / AtperoxP43)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326
PWM (Da):   %s   35228.04  
PI (pH):   %s   5.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVWANAKMRLALSLVTVFFGISLANLEVGFYSNTCPQAESIVKRVVSGAALSDPNLPAILLRLHFHDCFVEGCDGSILVNNGAISEKNAFGHEGVRGFEIVEAVKAELEAACPGVVSCSD
IVALAARDAISLANGPAYEVPTGRRDGRVSNMSLAKDMPEVSDSIEILKAKFMQKGLNAKDLVLLSAAHTIGTTACFFMSKRLYDFLPGGQPDPTINPTFLPELTTQCPQNGDINVRLPI
DRFSERLFDKQILQNIKDGFAVLQTDAGLYEDVTTRQVVDSYLGMLNPFFGPTFESDFVKAIVKMGKIGVKTGFKGEIRRVCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), no EST. Additionnal residus in N-term in Phytozome and TAIR
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST