Entry information : AtPrx45 (At4g30170 / PER45 / AtperoxP45 / ATP8a / Atperox8A / Atp8)
Entry ID 211
Creation 2006-04-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-10 (Achraf Jemmat)
Peroxidase information: AtPrx45 (At4g30170 / PER45 / AtperoxP45 / ATP8a / Atperox8A / Atp8)
Name (synonym) AtPrx45 (At4g30170 / PER45 / AtperoxP45 / ATP8a / Atperox8A / Atp8)
Class Class III peroxidase    [Orthogroup: Prx032]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Etiolated hypocotyls
Mixed tissues
Roots
Rosettes
Stamen Abscission Zone
Whole seedlings
Inducers Drought
Hormon treatment
Stress treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx45
start..stop
S start..stop
AlyPrx45 612 0 1..325 1..325
AhalPrx16 611 0 1..325 1..325
TsPrx45 606 0 1..325 3..327
BrPrx45-1Aa_other 602 0 1..325 1..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '211' 'join(14762922..14763137,14763293..14763481,14763819..14763984,14764076..14764482)' Exons


exon

Literature and cross-references AtPrx45 (At4g30170 / PER45 / AtperoxP45 / ATP8a / Atperox8A / Atp8)
Literature REFERENCE 1 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21
Protein ref. UniProtKB:   Q96522
DNA ref. Phytozome 12:   Chr4 (14762922..14764482)
mRNA ref. GenBank:   NM_119163
Cluster/Prediction ref. Phytozome Gene 12:   19647742 UniGene:   At.24710
Omic ref. AtProteome:   At4g30170 ATTED-II:   At4g30170 e-FP Browser:   At4g30170 ePlant:   At4g30170 Genevestigator:   At4g30170 TAIR:   At4g30170
Protein sequence: AtPrx45 (At4g30170 / PER45 / AtperoxP45 / ATP8a / Atperox8A / Atp8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (300)
PWM (Da):   %s   35691.99 (32917.6)  
PI (pH):   %s   9.37 (9.56) Peptide Signal:   %s   cut: 26 range:26-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKNTSQTIFSNFFLLLLLSSCVSAQLRTGFYQNSCPNVETIVRN
AVRQKFQQTFVTAPATLRLFFHDCFVR
GCDASIMIASPSERDHPDDMSLAGDGFDTVVKAKQAVDSNPNCRNKVSCADILALATREVVVLTGGPSYPVELGRRDGRISTKASVQSQLPQPEFNLNQLNGMFSRHGLSQTDMIALSGA
HTIGFAHCGKMSKRIYNFSPTTRIDPSINRGYVVQLKQMCPIGVDVRIAINMDPTSPRTFDNAYFKNLQQGKGLFTSDQILFTDQRSRSTVNSFANSEGAFRQAFITAITKLGRVGVLTG
NAGEIRRDCSRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 5 cDNA and 59 ESTs. Mainly found in roots. Also found by proteomic (Feiz, 2004)
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST