1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Entry ID 217
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Name (synonym) AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Mixed tissues
Siliques
Stamen Abscission Zone
Inducers Hormon treatment
Stress treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx51
start..stop		 S start..stop
AtPrx50 587 0 1..329 1..329
BstrPrx06 578 0 1..329 1..329
CrubPrx73 577 0 24..329 25..330
AhalPrx33 575 0 3..329 1..327
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Literature REFERENCE 1 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21
Protein ref. UniProtKB:   Q9SZE7
DNA ref. Phytozome 12:   Chr4 (17634786..17636082)
mRNA ref. GenBank:   NM_119917
Cluster/Prediction ref. Phytozome Gene 12:   19646731 UniGene:   At.28345
Omic ref. AtProteome:   At4g37530 ATTED-II:   At4g37530 e-FP Browser:   At4g37530 ePlant:   At4g37530 Genevestigator:   At4g37530 TAIR:   At4g37530
Protein sequence: AtPrx51 (At4g37530 / PER51 / AtperoxP51 / ATP37)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   35852.1 (33139.5) Transmb domain:   %s   i7-25o
PI (pH):   %s   8.38 (8.20) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVMNKTNLLLLILSLFLAINLSSAQLRGDFYAGTCPNVEQIVRN
AVQKKIQQTFTTIPATLRLYFHDCFVNGCDASVMIASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNLAGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIA
LSGAHTLGFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNIDPRVAINMDPNTPRQFDNVYYKNLQQGKGLFTSDQVLFTDSRSKPTVDLWANNGQLFNQAFISSMIKLGRVG
VKTGSNGNIRRDCGAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns), 4 cDNA and 5 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST