Entry information : CsaPrx04 (Cucsa.153430.1 / CUSPREPER)
Entry ID 22
Creation 2006-03-23 (Christophe Dunand)
Last sequence changes 2006-03-23 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx04 (Cucsa.153430.1 / CUSPREPER)
Name (synonym) CsaPrx04 (Cucsa.153430.1 / CUSPREPER)
Class Class III peroxidase    [Orthogroup: Prx242]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx04
start..stop
S start..stop
CsaPrx54 473 1e-169 1..322 1..322
CpPrx01 397 9e-140 20..329 14..325
CsaPrx55 388 6e-136 4..324 7..322
CsaPrx03 388 8e-136 3..321 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 542925..543131 207 N° 2 542620..542811 192 N° 3 541787..542377 591  
complement(join(541787..542377,542620..542811,542925..543131))


exon

Literature and cross-references CsaPrx04 (Cucsa.153430.1 / CUSPREPER)
Literature Rasmussen,J.B., Smith,J.A., Williams,S., Burkhart,W., Ward,E.R., Somerville,S.C., Ryals,J. and Hammerschmidt,R.1992 unpublished
Protein ref. UniProtKB:   Q39652
DNA ref. Phytozome 12:   scaffold01124 (543131..541787)
mRNA ref. GenBank:   M91373
Protein sequence: CsaPrx04 (Cucsa.153430.1 / CUSPREPER)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (307)
PWM (Da):   %s   35592.36 (33385.1)  
PI (pH):   %s   8.57 (8.39) Peptide Signal:   %s   cut: 23 range:23-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLPKMAAIVVVVALMLSPSQAQLSPFFYATTCPQLPFVVLNVVAQALQTDDRAAAKLIRLHFHDCFVNGCDGSILLVDVPGVIDSELNGPPNGGIQGMDIVDNIKAAVESACPGVVSCADILAISSQISVFLSGGPIWVVPMGRKDSRIANRTGTSNLPGPSETLVGLKGKFKDQGLDSTDLVALSGAHTFGKSRCMFFSDRLINFNGTGRPDTTLDPIYREQLRRLCTTQQTRVNFDPVTPTRFDKTYYNNLISLRGLLQSDQELFSTPRADTTAIVKTFAANERAFFKQFVKSMIKMGNLKPPPGIASEVRLDCKRVNPVRAYDVM*

Retrieve as FASTA  
Remarks Complete sequence from genomic and ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTACCTAAAATGGCAGCCATTGTTGTGGTGGTGGCTTTGATGCTATCACCCTCTCAAGCCCAGCTTTCTCCTTTCTTCTACGCCACCACATGCCCTCAGCTGCCTTTCGTTGTT
CTCAACGTGGTTGCCCAAGCCCTACAGACTGATGACCGAGCTGCTGCTAAGCTCATTCGCCTCCATTTTCATGATTGCTTTGTCAAT
GTATTATTTTATTTCATTTTCTTTTTTTTTCGT
ATTGCATAAACACATATCTAGTAAATGTTTTGTAACATGATGGATGAATCTACTCTTAATATTTTTTTGGTTTTGTGTAGGGGTGTGATGGATCGATTCTATTGGTAGACGTACCGGGCG
TTATCGATAGTGAACTTAATGGACCTCCAAATGGTGGAATCCAAGGAATGGACATTGTGGACAACATCAAAGCAGCAGTTGAGAGTGCTTGTCCAGGAGTTGTTTCTTGCGCTGATATCT
TAGCCATTTCATCTCAAATCTCTGTTTTCTTG
GTAATTACTTTAATTAAATTTATGTTTCCTATTCTTTCTATAAGTAGCTCAATTGAGATGCGGAGAATGCGATGAAATTAAAATCTCA
TACCCACTACATAAGCTAAGATGACAACTATTTTGAATGGTACAAAACATTTTTTTTAAAACCAAAAGTAAAACCCTGCCTACTTTTGTAAAGATAAATGGAGATTTGTTATCTTCGGCA
AGTAATAATGTTAACTTTTATGGTGTTTTGGCAGTCGGGAGGACCAATTTGGGTTGTACCAATGGGAAGAAAAGACAGCAGAATAGCCAATAGAACTGGAACCTCAAACTTACCTGGTCC
CTCAGAAACTCTAGTGGGACTTAAAGGCAAGTTTAAAGATCAAGGGCTTGATTCTACAGATCTCGTGGCTCTATCAGGAGCCCACACGTTTGGAAAATCAAGATGCATGTTCTTCAGTGA
CCGCCTCATCAACTTCAACGGCACAGGAAGACCCGACACAACGCTTGACCCAATATACAGGGAGCAGCTTCGAAGACTTTGTACTACTCAACAAACACGAGTAAATTTCGACCCAGTCAC
ACCCACTAGATTTGACAAGACCTATTACAACAATTTGATTAGCTTAAGAGGGCTTCTCCAAAGCGACCAAGAGCTCTTCTCAACTCCCAGAGCTGATACCACAGCCATTGTCAAAACTTT
TGCTGCCAACGAACGTGCCTTCTTTAAACAATTTGTGAAATCAATGATCAAAATGGGCAACCTCAAGCCTCCCCCTGGCATTGCATCAGAAGTTAGATTGGACTGTAAGAGGGTCAACCC
AGTCAGAGCCTACGACGTTATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTACCTAAAATGGCAGCCATTGTTGTGGTGGTGGCTTTGATGCTATCACCCTCTCAAGCCCAGCTTTCTCCTTTCTTCTACGCCACCACATGCCCTCAGCTGCCTTTCGTTGTT
CTCAACGTGGTTGCCCAAGCCCTACAGACTGATGACCGAGCTGCTGCTAAGCTCATTCGCCTCCATTTTCATGATTGCTTTGTCAAT
GGGTGTGATGGATCGATTCTATTGGTAGACGTA
CCGGGCGTTATCGATAGTGAACTTAATGGACCTCCAAATGGTGGAATCCAAGGAATGGACATTGTGGACAACATCAAAGCAGCAGTTGAGAGTGCTTGTCCAGGAGTTGTTTCTTGCGCT
GATATCTTAGCCATTTCATCTCAAATCTCTGTTTTCTTG
TCGGGAGGACCAATTTGGGTTGTACCAATGGGAAGAAAAGACAGCAGAATAGCCAATAGAACTGGAACCTCAAACTTACCT
GGTCCCTCAGAAACTCTAGTGGGACTTAAAGGCAAGTTTAAAGATCAAGGGCTTGATTCTACAGATCTCGTGGCTCTATCAGGAGCCCACACGTTTGGAAAATCAAGATGCATGTTCTTC
AGTGACCGCCTCATCAACTTCAACGGCACAGGAAGACCCGACACAACGCTTGACCCAATATACAGGGAGCAGCTTCGAAGACTTTGTACTACTCAACAAACACGAGTAAATTTCGACCCA
GTCACACCCACTAGATTTGACAAGACCTATTACAACAATTTGATTAGCTTAAGAGGGCTTCTCCAAAGCGACCAAGAGCTCTTCTCAACTCCCAGAGCTGATACCACAGCCATTGTCAAA
ACTTTTGCTGCCAACGAACGTGCCTTCTTTAAACAATTTGTGAAATCAATGATCAAAATGGGCAACCTCAAGCCTCCCCCTGGCATTGCATCAGAAGTTAGATTGGACTGTAAGAGGGTC
AACCCAGTCAGAGCCTACGACGTTATGTAA

Retrieve as FASTA