1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Entry ID 220
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Name (synonym) AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Hypocotyls
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx54
start..stop		 S start..stop
AlyPrx54 681 0 1..358 1..357
AruPrx54 660 0 1..358 1..358
BstrPrx43 655 0 1..358 1..358
NoffPrx54-1A 647 0 1..358 1..360
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '220' 'complement(join(2080207..2080691,2080781..2080946,2081103..2081294,2081388..2081621))' Exons►


exon

Literature and cross-references AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Literature Kupriyanova EV, Ezhova TA, Shestakov SV. Duplicated peroxidase genes AtPrx53 and AtPrx54 of Arabidopsis thaliana are a recombination hotspot. Dokl Biochem Biophys. 2010 Mar-Apr;431:90-3.
Protein ref. UniProtKB:   Q9FG34
DNA ref. Phytozome 12:   Chr5 (2081621..2080207)
mRNA ref. GenBank:   NM_120756
Cluster/Prediction ref. Phytozome Gene 12:   19668053 UniGene:   At.90
Omic ref. AtProteome:   At5g06730 ATTED-II:   At5g06730 e-FP Browser:   At5g06730 ePlant:   At5g06730 Genevestigator:   At5g06730 TAIR:   At5g06730
Protein sequence: AtPrx54 (At5g06730 / PER54 / AtperoxP54 / ATP29a / AtP29)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (327)
PWM (Da):   %s   37136.17 (34027.6) Transmb domain:   %s   i13-35o
PI (pH):   %s   4.33 (4.39) Peptide Signal:   %s   cut: 32 range:32-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVTSSSSTCDGFFIISLIVIVSSLFGTSSAQLNATFYSGTCPNA
SAIVRSTIQQALQSDARIGGSLIRLHFHDCFVNGCDGSLLLDDTSSIQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILALASEASVSLAGGPSWTVLLGRRDGLTANLSGANSSLPSPFEGLNNITSKFVAVGLKTTDVVSLSG
AHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQNGSNTGITNLDLSTPDAFDNNYFTNLQSNNGLLQSDQELFSNTGSATVPIVNSFASNQTLFFEAFVQSMIKMGNISP
LTGSSGEIRQDCKVVNGQSSATEAGDIQLQSDGPVSVADM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns), 7 cDNA and 10 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST