Entry information : SsqPrx01_A34-4-23 ( SSP2)
Entry ID 2205
Creation 2006-08-25 (Christophe Dunand)
Last sequence changes 2016-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-16 (Achraf Jemmat)
Peroxidase information: SsqPrx01_A34-4-23 ( SSP2)
Name (synonym) SsqPrx01_A34-4-23 ( SSP2)
Class Class III peroxidase    [Orthogroup: Prx157]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Senecio
Organism Senecio squalidus    [TaxId: 121554 ]
Cellular localisation N/D
Tissue type Flowers
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsqPrx01_A34-4-23
start..stop
S start..stop
SsqPrx02_Ox10 671 0 1..326 1..326
SsqPrx01_Ox8 664 0 1..326 1..326
SsqPrx01_OS-Bill4 662 0 1..326 1..326
SsqPrx01_Ox15 661 0 1..326 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23..421 399 N° 2 517..679 163 N° 3 763..1181 419  
join(23..421,517..679,763..1181)


exon

Literature and cross-references SsqPrx01_A34-4-23 ( SSP2)
Literature McInnis,S.M. et al., Isolation and characterization of a polymorphic stigma-specific class III peroxidase gene from Senecio squalidus L. (Asteraceae),unpublished unpublished
Protein ref. UniProtKB:   Q4A3Z2
DNA ref. GenBank:   AJ810533.1 (23..1181)
mRNA ref. GenBank:   AJ810531.1
Protein sequence: SsqPrx01_A34-4-23 ( SSP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   35682.31 (32740.7) Transmb domain:   %s   o10-32i
PI (pH):   %s   7.25 (7.21) Peptide Signal:   %s   cut: 28 range:28-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEVYSHLRTPIILFVVVFAALTSLALGCKVGFYQATCPKAETIVQSVVKSAIRTNPTYAPGILRLFFHDCFVNGCDASVLLDGSTSEQTASTNSHLRGFEVITAAKDRVETECPGVVSCADILALAARDSVVETGLPRWEVPTGRRDGLVSRAEDALKLPGSRDSAEVQIEKFAAKGLNIEELVTLVGGHTIGTSACARFVHRLYNYSNTNAPDPHIDQAFLPHLQTLCPEHGDITIRVDLDTGSVNNFDTSYYENLRKGRGVLESDTKLWTHHITQNLVQQFISVGRPNQLTFSKKFARAMVKLSQVEVKTGNEGEIRRVCNRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3) and 6 ESTs. Isolate="A34-4-23"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGTTTATTCCCATCTAAGAACACCCATAATCTTGTTTGTTGTCGTTTTCGCCGCCTTGACCAGCTTGGCACTAGGTTGCAAAGTTGGGTTCTATCAGGCCACATGCCCGAAAGCG
GAAACCATTGTGCAGTCTGTGGTTAAGTCTGCCATCCGGACTAACCCGACATATGCACCTGGTATACTAAGACTGTTTTTTCATGATTGTTTTGTTAATGGTTGTGATGCATCTGTTTTA
CTTGATGGTTCTACTTCTGAGCAAACCGCTTCAACGAATTCTCATTTGAGAGGCTTTGAAGTCATCACTGCTGCAAAGGATAGGGTCGAAACTGAATGTCCTGGAGTTGTATCTTGTGCG
GACATTCTTGCTCTCGCTGCTCGTGATTCTGTCGTCGAG
GTAATTAATTACTAGTCATAATAGCATGCATGCAATAAAGAGTTATAACTGTTTAAACAAGTAATCTTTTGATTTTTCAAA
CATATGCGTGCCAGACTGGGTTGCCTAGATGGGAAGTTCCAACAGGTCGGAGAGATGGATTAGTTTCACGGGCCGAAGATGCTCTAAAATTGCCTGGTTCAAGGGATTCTGCTGAAGTCC
AAATCGAGAAGTTTGCAGCCAAAGGTCTTAATATCGAAGAACTTGTTACCCTTGTTG
GTAAGTTAACTATGCACAACGAACGGAACTTACTACTAACAAAGAAATTAACATGTGTGTATC
TCGGTTTAATGGTTTATCAGGAGGACACACGATTGGGACATCCGCTTGTGCAAGATTTGTCCACAGGCTATATAACTATAGCAACACCAATGCACCGGATCCACATATTGACCAAGCATT
CCTTCCCCACCTACAAACCTTATGCCCAGAACATGGTGATATAACAATCCGTGTGGACTTAGATACAGGTAGCGTAAACAATTTCGACACATCATACTATGAAAACTTGAGGAAGGGGCG
AGGAGTACTTGAATCGGATACAAAGCTATGGACACACCATATCACACAAAACTTAGTGCAACAATTTATTTCTGTTGGGAGACCAAATCAGTTGACATTCTCCAAGAAGTTTGCGAGAGC
AATGGTGAAGTTAAGTCAAGTTGAGGTAAAGACCGGTAATGAAGGAGAAATTCGTAGGGTTTGTAACAGAATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGTTTATTCCCATCTAAGAACACCCATAATCTTGTTTGTTGTCGTTTTCGCCGCCTTGACCAGCTTGGCACTAGGTTGCAAAGTTGGGTTCTATCAGGCCACATGCCCGAAAGCG
GAAACCATTGTGCAGTCTGTGGTTAAGTCTGCCATCCGGACTAACCCGACATATGCACCTGGTATACTAAGACTGTTTTTTCATGATTGTTTTGTTAATGGTTGTGATGCATCTGTTTTA
CTTGATGGTTCTACTTCTGAGCAAACCGCTTCAACGAATTCTCATTTGAGAGGCTTTGAAGTCATCACTGCTGCAAAGGATAGGGTCGAAACTGAATGTCCTGGAGTTGTATCTTGTGCG
GACATTCTTGCTCTCGCTGCTCGTGATTCTGTCGTCGAG
ACTGGGTTGCCTAGATGGGAAGTTCCAACAGGTCGGAGAGATGGATTAGTTTCACGGGCCGAAGATGCTCTAAAATTGCCT
GGTTCAAGGGATTCTGCTGAAGTCCAAATCGAGAAGTTTGCAGCCAAAGGTCTTAATATCGAAGAACTTGTTACCCTTGTTG
GAGGACACACGATTGGGACATCCGCTTGTGCAAGATTT
GTCCACAGGCTATATAACTATAGCAACACCAATGCACCGGATCCACATATTGACCAAGCATTCCTTCCCCACCTACAAACCTTATGCCCAGAACATGGTGATATAACAATCCGTGTGGAC
TTAGATACAGGTAGCGTAAACAATTTCGACACATCATACTATGAAAACTTGAGGAAGGGGCGAGGAGTACTTGAATCGGATACAAAGCTATGGACACACCATATCACACAAAACTTAGTG
CAACAATTTATTTCTGTTGGGAGACCAAATCAGTTGACATTCTCCAAGAAGTTTGCGAGAGCAATGGTGAAGTTAAGTCAAGTTGAGGTAAAGACCGGTAATGAAGGAGAAATTCGTAGG
GTTTGTAACAGAATTAATTAA

Retrieve as FASTA