1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Entry ID 221
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-02-06 (Christophe Dunand)
Peroxidase information: AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Name (synonym) AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Class Class III peroxidase    [Orthogroup: Prx031]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Mixed tissues
Siliques
Inducer Methyl jasmonate treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx55
start..stop		 S start..stop
AlyPrx55 615 0 1..330 1..330
BstrPrx41 607 0 1..330 7..336
CrubPrx70 561 0 1..330 1..335
CagraPrx38 545 0 1..330 1..339
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Protein ref. UniProtKB:   Q96509
DNA ref. Phytozome 12:   Chr5 (4560028..4558862)
mRNA ref. GenBank:   NM_121417.4
Cluster/Prediction ref. Phytozome Gene 12:   19671780 UniGene:   At.70997
Omic ref. AtProteome:   At5g14130 ATTED-II:   At5g14130 e-FP Browser:   At5g14130 ePlant:   At5g14130 Genevestigator:   At5g14130 TAIR:   At5g14130
Protein sequence: AtPrx55 (At5g14130 / PER55 / AtperoxP55 / ATP20a / AtP20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (300)
PWM (Da):   %s   35721.53 (32274.9)  
PI (pH):   %s   4.66 (4.69) Peptide Signal:   %s   cut: 31 range:31-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDIRSDDAKKPMMMWFLGMLLFSMVAESNAQLSENYYASTCPSVE
LIVKQAVTTKFKQTVTTAPATLRMFFHDCFVEGCDASVFIASENEDAEKDADDNKSLAGDGFDTVIKAKTAVESQCPGVVSCADILALAARDVVVLVGGPEFKVELGRRDGLVSKASRVTGKLPEPGLDVRGLVQIFASNGLSLTDMIALSG
AHTIGSSHCNRFANRLHNFSTFMPVDPTMDPVYAQQLIQACSDPNPDAVVDIDLTSRDTFDNSYYQNLVARKGLFTSDQALFNDLSSQATVVRFANNAEEFYSAFSSAMRNLGRVGVKVG
NQGEIRRDCSAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 2), 6 cDNA and 5 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST