Entry information : GmAPx04 (Glyma11g11460)
Entry ID 2229
Creation 2007-02-14 (Felipe Teixeira)
Last sequence changes 2007-02-14 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmAPx04 (Glyma11g11460)
Name (synonym) GmAPx04 (Glyma11g11460)
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx04
start..stop
S start..stop
GmAPx03 541 0 1..287 1..287
VuAPx02 519 0 1..287 1..287
LjAPx02 511 0 1..287 1..287
MtAPx02 493 6.42e-179 1..287 1..287
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2229' 'complement(join(8166226..8166417,8167135..8167237,8167361..8167440,8167531..8167613,8167756..8167804,8167893..8167958,8169469..8169518,8169814..8169938,8170102..8170217))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8170102..8170217 114 N° 2 8169814..8169938 123 N° 3 8169469..8169518 48 N° 4 8167893..8167958 64
N° 5 8167756..8167804 47 N° 6 8167531..8167613 81 N° 7 8167361..8167440 78 N° 8 8167135..8167237 101
N° 9 8166226..8166417 190  
complement(join(8166226..8166417,8167135..8167237,8167361..8167440,8167531..8167 613,8167756..8167804,8167893..8167958,8169469..8169518,8169814..8169938,8170102. .8170217))


exon

Literature and cross-references GmAPx04 (Glyma11g11460)
Literature Shoemaker,R., Keim,P., Vodkin,L., Erpelding,J., Coryell,V., Khanna ,A., Bolla,B., Marra,M., Hillier,L., Kucaba,T., Martin,J., Beck,C., Wylie,T., Underwood,K., Steptoe,M., Theising,B., Allen,M., Bowers ,Y., Person,B., Swaller,T., Gibbons,M., Pape,D., Harvey,N., Schurk ,R., Ritter,E., Kohn,S., Shin,T., Jackson,Y., Cardenas,M., McCann ,R., Waterston,R. and Wilson,R. Public Soybean EST Project
DNA ref. Phytozome 12:   Gm11 (8170217..8166226)
EST ref. GenBank:   BM188323.1 [5' end]  CD397720.1 [3' end]
Protein sequence: GmAPx04 (Glyma11g11460)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287 (300)
PWM (Da):   %s   31571.37 (32605.0) Transmb domain:   %s   o258-280i
PI (pH):   %s   6.8 (4.67) Peptide Signal:   %s   cut: 29 range:29-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALPVVVDAEYLKEVDKARRDLRALIANRNCAPLMLRLAWHDAGTYDAKTKTGGPNGSIRNEEEYSHGANNGLKKAIDFQEVKAKYPKITYADLFLAGVVAVEVTGGPTIDFVPGRRDSKVSPNEGRLPDAKKGVPHLRDIFYRMGLTDRDIVALSGG
HT
GRAHPERSGFDGPWTEDPLKFDNSYFVELLKEDSAGLLKLPTDKALLEDAEFRCYVELYADEDAFFRDYAESHKKLSELGFVPSSKPISIKEGTILAQGAVGVVVATAVVILSYLYEV
RKRGK*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 23 ESTs. ESTs from GmAPx03 and GmAPx04 have been compile in the same Unigene Gma.6091.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTGCCGGTAGTCGTCGATGCAGAGTACCTCAAGGAGGTCGACAAGGCTCGCCGCGATCTCCGCGCACTCATCGCTAACAGGAACTGCGCTCCTCTCATGCTCCGATTAGCGTAA
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTAAACGATTGATTTTAATACCTAGATTTCGCTTCGTACACGGTCAACGCTGCGATCGTGCAACTGTGTGT
TTCCCTTTTCTGTGTTTGAATTAGCTTGATTTGATGCAGCTCTGGCACGATGCCGGAACTTACGATGCTAAGACCAAGACCGGTGGACCTAACGGTTCGATCCGGAACGAGGAAGAGTAT
TCTCACGGAGCCAATAATGGCTTGAAGAAAGCTATTGATTTCTGCC
GTATGCTTTTTCTTCATTCCTTACTTTTTATCTTTTCCTAAAATTATTTCGTTTTCATTTTGCTAGCTAGCTAG
GTTAGGAATTGTAATGCTCCGTGCTTATCTATTTGCACATACTTTGTGTTATTTGAGTATTGAATTAACCATAATACATATAGGCTTGAATTTGGTTTGTGATTTGTCATGGTCACGCGG
CCTTGTGTTGAATTGAACTCGCTTAGGATGTTCTTACCAAAATTGGAACTATGTCGGTCTCCTTGTCTTTCTAAGAGTTGGCTGATTTTCTGATGTCGCAGAGAGGAAGTGAAGGCAAAA
TATCCTAAAATTACATATGCAGATCTCTTCCAG
GTGATCATTTGTTTTCATTTAGTTGCTATAAAAGTCTGTAGTGAATCTGATAATTTTTTACTGAATTCATTAGGTAAAAATTATAGA
ATGGGGTCAATGGACTTTCAAACTTGTCTGGGATTTGCATGATAATTAATTAAGGGTTCCATTTTCTGCCACTATCAGTTCAAATTACTCTTTTTGTACACTGTTTTTTACTCAAATCTC
ATGGATGCTGCTGAGGCTTTGGTTTTCCTATAGTGTTAGGTGGGATTAGTTTATGACTCTTGTTTCTATTTTGTTGCCTGATCATGATTGAATTTCAGTATGAGGTGGATGGATGAATCT
TAAGGTTACAGACTTAACATGCCAGTGATGTAGTGCCTTGTTACACTTAAGACTCATCCTCTTATAATGTTTGACAACTCTGATTACTTATGGTTTCAAATTGTGGAACACATCCCATGA
TGCGGCCAGGATATTGTGGTTGGGTTCACAACCACATCACACCTTTTGATGTGTTTGAAAATCACTAAAAGATCTGCAACGTTCCACCAAAACAAATGCATCACACAGCAATGGGAATCA
AAGTTCTCAAACAAATTGTTCTTCACTCTTTCTATTTCTTTACTTAGTAGATTTAAAGTGAATTTCAAAGGGTTGGGGAGATTTTAGGATGTTGGCAAGTTGGTGAATGAAAGGTGGGAT
TTGGGAGGGAGGAGCAATAGATGTGGGATTTTGAATGAGTCATGATAAGTTACATTCAGTGCAAACATAAAATAATTTTATGCTGCAATGGCCACAATATTGCATCACAATAGCTAAAAT
GCCTGCAATTGCAGTGGCCACAACCATGTCTGCATCCACAACCACTACCACAATTTAAAACCAAAGACCACAATTGCAAGGGGATTGACAAACATTGCCCAGTTAATCAAGAATTCTTGA
TAGCTATATCTTTTTTGTATTAGGAGCAGTAGTACAGCTAGATGTTGCTAGTTAAGAAGTGTACAGGAGTACAATTGAAGCTCAAGCTCCTGTATTAGTTAATGGAATGAGTTTCAAGTT
TTAATAGCTTAAGCATTTACCTGGTTGTGGTCCAATTCTTTTGTGGCAAGTTTTTGACATGCATATAGTTAACGTTAGTGCCTAAGATTTCTACAATAAAGGTGAATATCATTTGATTTT
CTTATACACTAATGTACTAGTGTCAAAGGTTAGAAAATATCAGCAATTTGATATTCTGAAAATCAAAATTTCCCTTAAGATTACCAAAATTATTTATATCAGAATCAAGCAGTTACTGGA
TTTTTGTGTATATGACATACAAGCCATTTAAATCCAATGAGTGCATGAGTCCAGATTCTGTTGAAACAGAGAGGGAGGAGATTATCACTCATTGATAGGGTTGATAGGGCATAGCTTGTA
TAAAACAAGATTCATTTATAAGTAGAAAAAAGATTTAAACTAACTACCATATAGATTATACAAATCTGATTAAAAAATCATTTCTTTCTCCCTGTGCTTCCAGCTCTTGCGGGTGTTGTT
GCAGTTGAGGTTACTGGGGGTCCAACAATTGATTTCGTTCCTGGTAGAAGA
GTATGTTGTGCCATGCCTTTAGTCAGAATATTAATTATTATGAAATCACCAAATTGTGTTTTGTTCATG
TAATTTTCTATTCTTGTAGGAGATTCAAAAGTATCTCCTAATGAAGGGCGGCTTCCTGATGCTAAAAAAGGTGTGTTTTGAAATTTGTCAGTGATAATACTATTCTCTTCACCTGGACTG
TGAATGATGTTCTATTTTTTGTATTCCCTTCACAATTGACGAGGTTAAGAATGCAGTATGAAAGCATAAAAATATGTCAATGCTGTTGTTAGGTGTGTTCCACATCTCCGTGATATCTTT
TATCGAATGGGCTTGACTGACCGAGATATTGTTGCACTATCTGGAGGACATACACTG
GTAATTCTTCTTTTGTTTAATATCTTTTTATTATTTGCTGTGATTATGACTAGATTATTCTTA
TCTTACTTTCTGTGGTGATCTTATAAGGGGGGAGAGCACATCCAGAGAGATCAGGGTTTGATGGCCCTTGGACGGAGGACCCTCTGAAGTTTGATAACTCATACTTTGTGTAAGACTTGT
GTTGTGTGCAATACTATAGAGTTTCACTTTGTAGAGCTTCACTTTAGCCTCGCAATGCAATATTGGAAGAGTTTGATTTTTATCTACATCTAAATATCATTGTTAACATCAGGGGGAACT
TTTGAAAGAAGATTCTGCTGGGCTGCTTAAACTTCCAACAGACAAGGCTTTATTGGAGGATGCTGAATTTCGCTGTTATGTTGAGCTATATGCAAAG
GTAATTGAGATTAATTCAAATAA
CCACCGTTTTGAAATTTGTTTGATGTTGTGTCCAAATTACCAATTATTGTTTCTCAATAGCATTTCATGTGAATATCTGTTTACTATAAACACCATGAAGCTTGTAATCTTATTGCATTA
ATTATTAGATCAATCTTTTGGCCTGAGGTACCCACCAGGGTTGGCTTAATAGTGAGAGATTTGGGTAGTATGCATAAAGTTTTAGGTTCTATCCTTATCGCCACCATTATACAGTGTACA
CCAAAAAAAAATTCTTTTGGCCCAAGCTCATTCAGTAGCAGTTGAGATTAGTAGGATCCTTCTTCCCCATGTGCGTTGTGCTTTGGAATTTACTATGCTATCTTGACACTTCATTAGTTC
AAACAAACTGGCCCATTGACCTTTTCACCATTGGCTGGTCAGGTATTAATAAAATTACATACTTTGCCAACAATTGACTAAACGTTGGTCTTGTTTTCCTTCTTTAGACTAATGAAACTA
AAGTTTACATTAAACTAAATAACATGCTTGATAGTGTTAGCACTTGTATGTAGAGTTGTAGAATAACTTACCGAAGTTTCTGTTTTGCTCTAAACCCATTAAAGAAAATTAAGAGCATAC
TATTTTCAGCAATGTTCTGGCTGCTGTTAATGCATCATTGATTTGTGTGAATCTGTCTGCTGTCTCCTATTTTAAAACTCTGTCACTCTGGCAGGAGATGAGGATGCATTTTTTCGAGAT
TATGCTGAATCACATAAGAAACTTTCAGAGCTAGGCTTTGTGCCAAGTTCAAAGCCGATTTCTATTAAGGAAGGGACCATACTGGCACAAGGTGCTGTAGGAGTTGTAGTTGCTACCGCA
GTGGTGATCCTCAGTTACTTGTATGAAGTTCGCAAAAGAGGGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTGCCGGTAGTCGTCGATGCAGAGTACCTCAAGGAGGTCGACAAGGCTCGCCGCGATCTCCGCGCACTCATCGCTAACAGGAACTGCGCTCCTCTCATGCTCCGATTAGCCTGG
CACGATGCCGGAACTTACGATGCTAAGACCAAGACCGGTGGACCTAACGGTTCGATCCGGAACGAGGAAGAGTATTCTCACGGAGCCAATAATGGCTTGAAGAAAGCTATTGATTTCTGC
C
AGGAAGTGAAGGCAAAATATCCTAAAATTACATATGCAGATCTCTTCCAGCTTGCGGGTGTTGTTGCAGTTGAGGTTACTGGGGGTCCAACAATTGATTTCGTTCCTGGTAGAAGAGAT
TCAAAAGTATCTCCTAATGAAGGGCGGCTTCCTGATGCTAAAAAAG
GTGTTCCACATCTCCGTGATATCTTTTATCGAATGGGCTTGACTGACCGAGATATTGTTGCACTATCTGGAGGA
CATACACTG
GGGAGAGCACATCCAGAGAGATCAGGGTTTGATGGCCCTTGGACGGAGGACCCTCTGAAGTTTGATAACTCATACTTTGTGGAACTTTTGAAAGAAGATTCTGCTGGGCTG
CTTAAACTTCCAACAGACAAGGCTTTATTGGAGGATGCTGAATTTCGCTGTTATGTTGAGCTATATGCAAAG
GATGAGGATGCATTTTTTCGAGATTATGCTGAATCACATAAGAAACTT
TCAGAGCTAGGCTTTGTGCCAAGTTCAAAGCCGATTTCTATTAAGGAAGGGACCATACTGGCACAAGGTGCTGTAGGAGTTGTAGTTGCTACCGCAGTGGTGATCCTCAGTTACTTGTAT
GAAGTTCGCAAAAGAGGGAAGTAA

Retrieve as FASTA