Entry information : GmAPx05 (Glyma01g36940)
Entry ID 2230
Creation 2007-02-14 (Felipe Teixeira)
Last sequence changes 2011-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmAPx05 (Glyma01g36940)
Name (synonym) GmAPx05 (Glyma01g36940)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation Peroxisomal
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx05
start..stop
S start..stop
GmAPx06 336 9e-117 1..296 1..280
MtAPx05 333 1e-115 1..295 1..278
MeAPx09 311 8e-107 1..244 1..244
VuAPx02 306 1e-104 1..243 1..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49334791..49334903 113 N° 2 49335821..49335945 125 N° 3 49336022..49336071 50 N° 4 49336197..49336262 66
N° 5 49336376..49336424 49 N° 6 49336688..49336773 86 N° 7 49336870..49336949 80 N° 8 49337057..49337153 97
N° 9 49338310..49338546 237  
join(49334791..49334903,49335821..49335945,49336022..49336071,49336197..49336262 ,49336376..49336424,49336688..49336773,49336870..49336949,49337057..49337153,493 38310..49338546)


exon

Literature and cross-references GmAPx05 (Glyma01g36940)
Literature Shoemaker,R., Keim,P., Vodkin,L., Erpelding,J., Coryell,V., Khanna ,A., Bolla,B., Marra,M., Hillier,L., Kucaba,T., Martin,J., Beck,C., Wylie,T., Underwood,K., Steptoe,M., Theising,B., Allen,M., Bowers ,Y., Person,B., Swaller,T., Gibbons,M., Pape,D., Harvey,N., Schurk ,R., Ritter,E., Kohn,S., Shin,T., Jackson,Y., Cardenas,M., McCann ,R., Waterston,R. and Wilson,R. Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm01 (49334791..49338546)
EST ref. GenBank:   AW309914
Cluster/Prediction ref. UniGene:   Gma.4678
Protein sequence: GmAPx05 (Glyma01g36940)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   300
PWM (Da):   %s   33662.54 Transmb domain:   %s   o274-291i
PI (pH):   %s   9.15
Sequence 341
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEPVVDDEYLKEIDKARRELRAFITSNQCAPLMLRLAWNDAATYDARNRAGGPNGSIRTDKELKHEANEGLLKATQLCEHVKAKLKKVSYADLYQLAGVVAIEVSGGPTIEFLPGRKDSMESSAEGLLPDVKQGASIIRNIFSRMGISDDKHIVALCGGLTWGETLKDRSDSKGQWPKDPLKFDNSYYKKILSKDLSSRLPIEDALLTDQSFRRHVEEYSKDENSFFKEYAMSHKKLSELGYNLKKQNQSKVPDEEQNQPKGPYEKLNQHRGLIGIGIVSVVTVILGYLLKRKKNQLKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 8 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGAACCTGTTGTTGACGACGAATATCTCAAGGAAATAGACAAGGCTCGACGTGAACTTCGCGCTTTCATCACCAGCAACCAATGCGCTCCTCTCATGCTTCGATTAGCGTACATCA
CTCACTACTGCTTTCATTTCTTAACTTCTGAAGTAACATGTCAATAAGTCCTTTTAAAAGATTCCTTTCCTTTTTTCATCCATGACAATTTGAAATAATTTACATATCTGATTTAACTAT
TTAAATTCCTTTAATGTAACATATAGATTTTAAAAAAAAAAACAACTTAAAGAATGTAATAACTTATTTTTAAAAGACTTTTATAATCAATGTTTTGTAATTTAAATTTTAATGGAGTTA
TATATTATAAGAATTTATAAGATTTGAAATGACTTACATTTACATGAGATTATAAAATTTGAAAGGGTTGATATTTTAACGAACATTTACAGTTAAAAGAAATGTCACACCTCTTTACAC
TTTCTTTCTTTTGTTATTTCCTAGTTACAAATTTCCCTTTTAAAGTACTAATACAGCACATGTAAAAATATATAGTAAAAAAATCTTTTACCTAATTACAATGAATGTATGCAGGATTGA
AAGAAAGAAATGATCAAACATTTATACTGCCTTCACGAAAAGATAAAGAATTATGTGACAGGAGACAAAAAAAATAATTCTGGTAACGCAAAATAAAAAGTGTCCAGAAATATGGGTGTA
ACTGGTGGATAAATATAATACTACTATTTATGTCTCTTACTCAAAAAACTCACCCAAAATCGACCGAAATCCACCATATATACAATATAATCCATCAATATTATAAGATTTTTTTTGTAA
TTCACAAAAAGTCTGAATTAGACATCATCAAATTTGGACATCATATCTACAAAATTCAGATAATCATAACTGAATATGACAGTACATTTAAACATCTTAATTATATTTTAAAATCTCAAT
GCAATGTGCATCTCCAAATAAATTCTCTATAGTCTCATAAAATTAATTAATTACATACTCTTTACACAGGTGGAACGATGCTGCCACCTACGATGCCAGAAACAGAGCAGGAGGCCCCAA
CGGTTCTATCAGGACTGATAAAGAGTTGAAACACGAAGCAAACGAGGGATTGTTAAAAGCAACTCAATTATGTG
GTCAATTTCCTTTCACTCAACTCAAGCATGCTTATTTATTATTCTA
CCTCTTAATTCGTTTTTATTTCCCAAACAGAGCATGTGAAGGCCAAACTTAAAAAAGTTTCATACGCAGACCTTTACCAGGTTATTTTAATTAACATAGATATTGTGATAATTAAACAAC
TTAATTAGACTAGAAAACAGGGGATCCAAAATCAATTTAGTTTGATGATTATATTAACTCTTATACGGTTGGATTTGCATTTCAGCTAGCTGGTGTTGTTGCAATAGAGGTCTCTGGGGG
TCCAACTATTGAATTTTTGCCTGGGAGAAAA
GTAATTAAGTATATCATGCGCAAGTTTTGTTTACCCCTCATAATGCACATGTTTCGATTTTCGATACTTTTAACTTCATATTTACTATG
CTACATTACTACTTTCTTTACTAGGATTCAATGGAATCTTCAGCAGAAGGGCTTCTTCCAGATGTCAAACAAGGTATACTATATACTACTTTAATTTCTTTACTAGGATACACGTGTTAT
ATATCTTATGAATAATAAAGATTTAATTTGCCCTGCATTGTTTGGTTGTGTTCCTCTTTTTATTTGCAATTTGGATCTAGTTGTTAAAACATTCAACACACATGGTCTTCTATTTAATCA
TTACGTATTCTGTCTGATGATATTCTAAGTTTTTGGAATCTTGACTTACAAGTTACAATTGTTATGAAAAAAAAAATTGATATGAAAAATTTTCAGGTGCATCGATTATAAGGAATATAT
TTTCTCGTATGGGTATAAGTGATGATAAACACATCGTTGCCCTATGTGGAGGCCTCACTTGG
GTAAGAACGATATATCCAAAAGTTCCTATGCATGAGTCCGTATTTATAGTTTTAACCA
TACATTCAATCTCATTATTATTCACGTCAATTGATAAGGGGGAAACACTTAAAGATCGTTCTGACTCTAAAGGTCAATGGCCAAAGGACCCTTTGAAGTTTGATAACTCCTATTATAAGT
AAGATGTCTAATTACATGATGACAATTGTTTTCTTTTTAAGATGTATACAAATTTCTGTCAAAAAAAGATGTATAAAAATTGAAATTTCTTATAACACTGAACAGGAAAATATTGAGTAA
GGATTTATCATCTAGGCTTCCCATAGAAGATGCTTTACTAACCGATCAAAGCTTCCGCCGCCATGTTGAAGAGTATTCAAAG
GTAAACGTGTAATGACCAAAGAGTAGGGTTTTATTTTA
CTTTTTATTATTATTTAGACTTAAATATAATTTTGGTCTTTTTAATTCATTAGATCAATACTTTTGATTTTTCTATTTTAAGATAAAGACATTCAATTTATTTATTTTAAAAAAGTTATA
ATTGTTGTCCTTTATGTCAAAATAAAGACATTAGTTCTCCTATTTTACAAAATTTTTAATTTTAATCAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
GATCTAACATATTCATTTAAAGTATCATAAAAAATGATTTAATTAATTGTTATGTAAGAAATAAAATAAATAAAACATAAATAAAATTGAAGATTGAACCAAAATTATTAATTTTTTAAA
AAATATGGGATCAAAATTTTGAATTTTAAAAAATAGAAGGATTAAATATCTCTATTTTAAAACATAAAGAATAAAATCAATTTTTTTCAAAACAGATAAACCAAATATCTCTATTTTAAA
ATAGAAAACCAAAATTATACATTAAACAAAATATGACACTCAAATTACATTTATTTCAAATGAGTTGGAAACGACATATTACCGTCAACTATTTATAGTAATATAAAATTAGGTTCAAAT
TTAACATACTATATTTTTTTATAATAATATTTTTAAAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNTATAATAATATTTTTTCCAAGATTTTATTATACAAGGATAATTTCTCATAACTTTTAGAATAAAAAATTAATACAGTTAAAATTGATACATTTGATACAATTAGTAAATTA
CATTTATTAGATAAAATCAAACAGTTCACTCGAGTGAGCATTGAGTGAACTTTGAGGTATGTATTGATCTCGTGAACTCCCAAAACTCAATTTACTTCAATTTTTCTCAATAAAAAAACA
ATTCAAATTTCGATCTCACCAAATCAGATTTAAAATATGAATTCAAATTCTTAACCATTTGAATTTTATTCAATGACTCTGATTTCTTAACCACATCAACCGTGCTCATTTTTTTTAGTA
TATTATTGAGTCACAATCCTAATTTTCTGTTGTAATAGGATGAGAATAGTTTCTTCAAAGAATATGCAATGTCACATAAGAAACTCTCAGAACTAGGCTACAATCTCAAGAAGCAAAATC
AATCAAAGGTACCAGATGAGGAGCAAAATCAGCCCAAGGGACCATATGAGAAGCTAAATCAGCACAGGGGACTTATAGGAATCGGTATAGTATCCGTGGTGACCGTGATATTAGGTTACT
TACTCAAGAGGAAGAAAAACCAGTTGAAGAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGAACCTGTTGTTGACGACGAATATCTCAAGGAAATAGACAAGGCTCGACGTGAACTTCGCGCTTTCATCACCAGCAACCAATGCGCTCCTCTCATGCTTCGATTAGCGTGGAACG
ATGCTGCCACCTACGATGCCAGAAACAGAGCAGGAGGCCCCAACGGTTCTATCAGGACTGATAAAGAGTTGAAACACGAAGCAAACGAGGGATTGTTAAAAGCAACTCAATTATGTG
AGC
ATGTGAAGGCCAAACTTAAAAAAGTTTCATACGCAGACCTTTACCAG
CTAGCTGGTGTTGTTGCAATAGAGGTCTCTGGGGGTCCAACTATTGAATTTTTGCCTGGGAGAAAAGATTCAA
TGGAATCTTCAGCAGAAGGGCTTCTTCCAGATGTCAAACAAG
GTGCATCGATTATAAGGAATATATTTTCTCGTATGGGTATAAGTGATGATAAACACATCGTTGCCCTATGTGGAGGCC
TCACTTGG
GGGGAAACACTTAAAGATCGTTCTGACTCTAAAGGTCAATGGCCAAAGGACCCTTTGAAGTTTGATAACTCCTATTATAAGAAAATATTGAGTAAGGATTTATCATCTAGGC
TTCCCATAGAAGATGCTTTACTAACCGATCAAAGCTTCCGCCGCCATGTTGAAGAGTATTCAAAG
GATGAGAATAGTTTCTTCAAAGAATATGCAATGTCACATAAGAAACTCTCAGAAC
TAGGCTACAATCTCAAGAAGCAAAATCAATCAAAGGTACCAGATGAGGAGCAAAATCAGCCCAAGGGACCATATGAGAAGCTAAATCAGCACAGGGGACTTATAGGAATCGGTATAGTAT
CCGTGGTGACCGTGATATTAGGTTACTTACTCAAGAGGAAGAAAAACCAGTTGAAGAAATGA

Retrieve as FASTA