Entry information : GmAPx06 (Glyma11g08320)
Entry ID 2231
Creation 2007-02-14 (Felipe Teixeira)
Last sequence changes 2011-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmAPx06 (Glyma11g08320)
Name (synonym) GmAPx06 (Glyma11g08320)
Class Ascorbate peroxidase    [Orthogroup: APx2012]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx06
start..stop
S start..stop
MtAPx05 477 1.03e-172 1..280 1..281
LsaAPx02 429 1.01e-153 1..279 1..284
NnAPx02 427 5.01e-153 1..278 1..282
LeAPx06 426 1.65e-152 1..278 1..286
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2231' 'complement(join(5900778..5900951,5901062..5901164,5901259..5901338,5901439..5901521,5902179..5902227,5902317..5902382,5902572..5902621,5902703..5902827,5902919..5903031))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5902919..5903031 111 N° 2 5902703..5902827 123 N° 3 5902572..5902621 48 N° 4 5902317..5902382 64
N° 5 5902179..5902227 47 N° 6 5901439..5901521 81 N° 7 5901259..5901338 78 N° 8 5901062..5901164 101
N° 9 5900778..5900951 172  
complement(join(5900778..5900951,5901062..5901164,5901259..5901338,5901439..5901 521,5902179..5902227,5902317..5902382,5902572..5902621,5902703..5902827,5902919. .5903031))


exon

Literature and cross-references GmAPx06 (Glyma11g08320)
Literature Shoemaker,R., Keim,P., Vodkin,L., Erpelding,J., Coryell,V., Khanna ,A., Bolla,B., Marra,M., Hillier,L., Kucaba,T., Martin,J., Beck,C., Wylie,T., Underwood,K., Steptoe,M., Theising,B., Allen,M., Bowers ,Y., Person,B., Swaller,T., Gibbons,M., Pape,D., Harvey,N., Schurk ,R., Ritter,E., Kohn,S., Shin,T., Jackson,Y., Cardenas,M., McCann ,R., Waterston,R. and Wilson,R. Public Soybean EST Project
DNA ref. Phytozome 12:   Gm11 (5903031..5900778)
EST ref. GenBank:   AW707196.1 [Other strain]
Cluster/Prediction ref. UniGene:   Gma.24019
Protein sequence: GmAPx06 (Glyma11g08320)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   280 (137)
PWM (Da):   %s   31162.33 (12083.9) Transmb domain:   %s   o250-272i
PI (pH):   %s   9.51 (4.26) Peptide Signal:   %s   cut: 67 range:19-155
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKPRVDAEYLKEIEKARRDLRALISNRNCAPLMLRLAWHDAGTYDAKTNTGGPNGSIRNRQELNHAANKGLETALAFCEEVKAKHPKISYADLYQLAGVVAVEVTGGPTINFVPGRKDS
LESPAEGRLPDAKQGASHLRDIFYRMGLGDKDIVALSGGHTLGKAHKDRSDFHGQWTKDPLKFDNSYFVELLRGESKDLLKLPTDKALVEDPNFRKYVELYAKDEDAFFSDYATSHKKLS
ELGFIFKNHRSILAKGVIGIAIVLTAVILGYLRELNKKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11, 8 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGCCTAGAGTTGATGCTGAGTATCTGAAGGAAATCGAGAAGGCTCGTCGTGACCTTCGCGCTCTTATCTCCAACAGAAACTGCGCCCCTCTCATGCTTCGATTAGCGTACGTT
TCATTTCTTTCTCTATATATCCATATATTTAGAACATTAATTTCATATAGCAAACATCTAGTGACAATAATATATAATTTGTAGGTGTGGCATGATGCTGGTACTTACGATGCTAAAACA
AACACAGGAGGCCCTAATGGTTCTATCAGAAACAGACAAGAGTTGAATCACGCAGCAAACAAGGGACTGGAAACAGCACTTGCCTTCTGTG
GTTAGTTTGATGAAATTAAATTCTCTTAT
ATTCTATCAGTTTAATCCTCACTGATTTAGTTTTGGTTTCTTTGGATAATAGAGAGGAAGTGAAGGCCAAACATCCAAAAATTTCATATGCCGACCTTTACCAGGTTAATTATTTTNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGGTATCTAATTTTTTTCCCTTCATTG
ATATTTGGAGTCATAGATTAACTTGTATATCTGTGATTGGATTTGTATTTCAGCTCTAGCTGGTGTTGTTGCAGTAGAAGTTACCGGGGGGCCAACTATTAACTTTGTTCCCGGGAGAAA
A
GTATGTTTCATGCGCAAGTTTTGTTTGGTCTCTTCGATAACATTATCTTTAGATTTACTATATACTACTTTTCTTTATTATTATACTAGGAGATTCATTGGAATCTCCAGCAGAGGGGC
GTCTTCCAGATGCCAAACAAG
GTAAATCGATCACTGTGCTAATTGTTTCGTCTCCAGTTTTTTTCTGCCATTCCTTCCCTTGATAAAAACTATTTTGCGACCTTACTTTTAATTTATAAT
AATACTCCCTTATGTAAAATGTCACACTAATTAGGAAAACAATCTTTGGACACTTAGATGCTAGAGAGAAAGGAGAAAACAAAATGAATTATTTTTAACAAATACAAAATGAAGTGTTAT
CCAATAACATGGTTACTTAAAAAGTCAATTAACGTGAAAAGCTCTCCCATGGGTTGGCTCTGCTGTTGTTCAATAGTGTTACCATTTGACAAGAGTTGAATTTTGCAACCTGCTTATCGT
ATAAATAGCCATTTCATTACGTTAAACGTTGTTCAATACTTACTAGCTTTGACTAAAACTTTTGGAGTAGCCAAAAGCCTATGAACAATTTTTTTTTTATATGTATATAATTAAGGGGAG
CCAAAAGACAAAATGACTATACACTGACACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATTTATGATTAGATGATAAT
CAAAAATTATTTTACAGCCTGAAAACACATGGATAAATCTCTTCAAAAAATTCATCGATGTATATGAAATAATTTCAGGTGTGCGTCGCATCTAAGAGATATCTTTTATCGCATGGGTCT
AGGTGACAAAGACATTGTGGCTCTATCCGGAGGTCACACTTTG
GTAAAAACAATATTACATCCTAAAGTTCTTTAATTAGTATATAGTTAAAGTATACACTTAATCTCATCCAATTCACT
TCAATTGTTTGTATTCGTTTAAGGGGGTAAGGCACATAAAGATCGTTCTGACTTTCATGGTCAATGGACAAAGGACCCTTTGAAGTTTGATAATTCCTATTTTGTGTAAGATGTTCAATT
ACACTACATACGTCAATTGTTTGTTTATTTAAAATGTATAAAAATAAAAATAATTGAAATTTCTCGTAACACTAAACAGGGGGAATTGCTGAGAGGGGAGTCAAAAGATTTACTGAAGCT
TCCCACAGACAAGGCTCTAGTTGAAGATCCTAATTTCCGCAAGTATGTTGAACTATATGCGAAG
GTAACTACAGACAAAGAGTTGAAAACATTTTACTGTCACTATTTTTTTTATCAATA
TAATAATAAAAAGAATTTTGGTTCACACTAATAATTTTCAATTGTACTATGTAGGAGATGAAGATGCTTTTTTCTCAGATTATGCAACCTCACACAAAAAACTCTCAGAGCTGGGCTTTA
TTTTCAAGAATCATCGTTCCATATTGGCCAAGGGAGTTATAGGAATTGCTATTGTCTTAACCGCCGTGATCTTGGGTTACTTACGTGAACTGAACAAAAAAACCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGCCTAGAGTTGATGCTGAGTATCTGAAGGAAATCGAGAAGGCTCGTCGTGACCTTCGCGCTCTTATCTCCAACAGAAACTGCGCCCCTCTCATGCTTCGATTAGCGTGGCAT
GATGCTGGTACTTACGATGCTAAAACAAACACAGGAGGCCCTAATGGTTCTATCAGAAACAGACAAGAGTTGAATCACGCAGCAAACAAGGGACTGGAAACAGCACTTGCCTTCTGTG
AG
GAAGTGAAGGCCAAACATCCAAAAATTTCATATGCCGACCTTTACCAG
CTAGCTGGTGTTGTTGCAGTAGAAGTTACCGGGGGGCCAACTATTAACTTTGTTCCCGGGAGAAAAGATTCA
TTGGAATCTCCAGCAGAGGGGCGTCTTCCAGATGCCAAACAAG
GTGCGTCGCATCTAAGAGATATCTTTTATCGCATGGGTCTAGGTGACAAAGACATTGTGGCTCTATCCGGAGGTCAC
ACTTTG
GGTAAGGCACATAAAGATCGTTCTGACTTTCATGGTCAATGGACAAAGGACCCTTTGAAGTTTGATAATTCCTATTTTGTGGAATTGCTGAGAGGGGAGTCAAAAGATTTACTG
AAGCTTCCCACAGACAAGGCTCTAGTTGAAGATCCTAATTTCCGCAAGTATGTTGAACTATATGCGAAG
GATGAAGATGCTTTTTTCTCAGATTATGCAACCTCACACAAAAAACTCTCA
GAGCTGGGCTTTATTTTCAAGAATCATCGTTCCATATTGGCCAAGGGAGTTATAGGAATTGCTATTGTCTTAACCGCCGTGATCTTGGGTTACTTACGTGAACTGAACAAAAAAACCAAT
TGA

Retrieve as FASTA