Entry information : PpePrx12 (ppa008503m)
Entry ID 2258
Creation 2005-09-23 (Christophe Dunand)
Last sequence changes 2011-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx12 (ppa008503m)
Name (synonym) PpePrx12 (ppa008503m)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type Fruits
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx12
start..stop
S start..stop
MdPrx02 630 0 17..329 22..335
FvPrx02 624 0 17..328 18..330
FaPrx01 624 0 17..328 18..330
TcPrx18 611 0 2..328 3..329
Gene structure Fichier Exons


exon

Literature and cross-references PpePrx12 (ppa008503m)
Literature Le Dantec,L., Cosson,P., Renaud,C., Garcia,V., Dumoulin,P., Rothan ,C., Filippi,G., Laigret,F., Moing,A. and Dirlewanger,E.
Peach (Prunus persica (L.) Batsch) fruit ESTs from two early development stages, Unpublished (2004).

DNA ref. Phytozome 12:   scaffold_4 (992673..994294)
EST ref. GenBank:   AJ872394 [3' end]
Protein sequence: PpePrx12 (ppa008503m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (308)
PWM (Da):   %s   37509.85 (35127.7)  
PI (pH):   %s   7.97 (7.77) Peptide Signal:   %s   cut: 22 range:22-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSRALFFFALLAFSAVSCFAENEEDPGLVMDFYKDSCPQAEDVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRSLSEKEMDRSFGMRNFRYIEEIKEALERECPGV
VSCSDILVLSAREGVVRLGGPFIPLKTGRRDGRRSRAEILEQYLPDHNESMSTVLEKFADMGIDTPGLVALLGAHSVGRTHCVKLVHRLYPEVDPQLNPDHVGHMLKKCPDAIPDPKAVQ
YVRNDRGTPMIFDNNYYRNILDNKGLMMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSKAFTILSENNPLTGTKGEIRQQCNVANKIHD*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Cultivar "Fantasia".
DNA
Send to BLAST
CDS
Send to BLAST