Entry information : PerVP05-2_CBS613 (VPL2 / PerVP05-2_CBS613)
Entry ID 2299
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2011-11-25 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2017-03-15 (Marcel Zamocky)
Peroxidase information: PerVP05-2_CBS613 (VPL2 / PerVP05-2_CBS613)
Name (synonym) PerVP05-2_CBS613 (VPL2 / PerVP05-2_CBS613)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus eryngii    [TaxId: 5323 ]
Cellular localisation Secreted
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PerVP05-2_CBS613
start..stop
S start..stop
PerVP05-1_CBS613 720 0 1..361 1..361
PerVP05_CBS458 718 0 1..361 1..361
PoVP05_PC9 704 0 1..361 1..361
PsaVP01 697 0 1..361 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 845..908 64 N° 2 964..1100 137 N° 3 1156..1214 59 N° 4 1268..1402 135
N° 5 1453..1574 122 N° 6 1631..1706 76 N° 7 1759..1795 37 N° 8 1854..1861 8
N° 9 1910..1990 81 N° 10 2045..2114 70 N° 11 2173..2182 10 N° 12 2230..2265 36
N° 13 2330..2502 173 N° 14 2556..2595 40 N° 15 2661..2685 25 N° 16 2743..2755 13
join(845..908,964..1100,1156..1214,1268..1402,1453..1574,1631..1706,1759..1795,1 854..1861,1910..1990,2045..2114,2173..2182,2230..2265,2330..2502,2556..2595,2661 ..2685,2743..2755)


exon

Literature and cross-references PerVP05-2_CBS613 (VPL2 / PerVP05-2_CBS613)
Literature Ruiz-Duenas F.J., Martinez M.J., Martinez A.T. Molecular characterization of a novel peroxidase isolated from the ligninolytic fungus Pleurotus eryngii. Mol. Microbiol. 31:223-235(1999).
Protein ref. UniProtKB:   O94753
DNA ref. GenBank:   AF007224.1
mRNA ref. GenBank:   AF007222.1
Protein sequence: PerVP05-2_CBS613 (VPL2 / PerVP05-2_CBS613)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (339)
PWM (Da):   %s   37512.76 (35363.6)  
PI (pH):   %s   4.34 (4.29) Peptide Signal:   %s   cut: 23 range:23-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFKTLSALALALGAAVQFASAAVPLVQKRATCDDGRTTANAACCILFPILDDIQENLFDGAQCGEVHESLRLTFHDAIGFSPTLGGGGADGSIIAFDTIETNFPANAGIDEIVSAQKPFVAKHNISAGDFIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPDSVDSILARMGDAGFSPVEVVWLLASHSIAAADKVDPIPGTPFDSTPGVFDSQFFIETQLKGRLFPGTADNKGEAQSPLQGEIRLQSDHLARDPQTACEWQSMVNNQPKIQNRFAATMSKMALLGQDKTKLIDCSDVIPTPPALVGAAHLPAGFSLSDVEQCAATPFPALTADPGPVTSVPPVPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Strain="ATCC 90787/CBS 613.91/IJFM A169".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCCGCTCTCGCGCTTGCGCTCGGCGCCGCTGTCCAGTTCGCGAGTGGTGGGCTTCGTCTCTGACCACAATGTCGAGGCAACCCTGCTGACTGGTATTTTAGC
TGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGACGACGGACGCACCACCGCAAATGCTGCATGTTGCATTCTGTTCCCCATCCTCGATGACATCCAAGAAAACCTCTTCGACGGTGC
CCAGTGTGGAGAAGAG
GTGTTATACCCATTGTCCTAATGCAGAACGGCTATTAATTCACGCGCGTACACAGGTGCACGAGTCCCTTCGTTTGACTTTCCACGATGCAATCGGTTTCTCTC
CTACTTTAGG
GTAAGGTAACGATCACCACTCGTGTTGTCTAATTTCTAACCCATGCACAACAGCGGAGGAGGAGCTGACGGTTCCATCATCGCGTTCGACACCATTGAGACTAATTTCCC
CGCCAATGCTGGCATCGATGAAATCGTCAGTGCTCAGAAGCCATTCGTGGCTAAACACAACATCTCCGCCGGCGACTT
GTAAGCAGTTCAAGCCAAAGGTTAAAGTGACCCTTACAAATC
AATTCTAGCATTCAATTTGCTGGCGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCTTTCTTCTTGGGTCGCCCGGATGCCGTGGCCGCCTCCCCGGACCACCTCGTGCCA
GAGCCTTTTG
GTACGTTTGGATATGGTAAAATTATCAACGAGAACTGAGGGTGTGGGCTCGCATAGATTCTGTTGACTCCATTCTTGCCAGAATGGGTGACGCAGGCTTCAGTCCCGTCG
AGGTTGTTTGGCTCCTGGCTTC
GTGAGTGCATGGAGATATGTAAGTACCACCATCGATCTAATTTGTTGCCTAGGCACTCCATTGCCGCTGCCGACAAGGTTGACCCATCGGTAAGTCGA
GCTGCATTGGCAAGTTTGTTGTGAAGGCTAATACCTGATAATTGTCTAGATTCCTGGGTAAGAGCGAACATCCACTGACGCGGCATGCTACTGACTTCATGTCAGAACGCCATTCGATTC
AACCCCCGGAGTTTTTGATTCTCAATTCTTCATCGAAACGCAACTTAAAGGCAGACTCTTCCCAGG
GTAAGCGATTCCATTTCTTCTCACCACGATATGACCCATCATGTTTGTGTTTAG

CACTGCTGACAACAAGGGAGAAGCCCAATCTCCATTGCAAGGAGAGATCAGGCTTCAGTCCGATCACTTG
GTGAGACCATTGTAGTTCATTATTCTATCAGTAATACTGACAAATATCCA
CTGGATAGTTGGCTAGAGGTACGATTCTTCCTTGCAGCCTTGTTAATGCTCACCGCCTCCCAAAGACCCCCAGACTGCCTGCGAATGGCAGTCCATGGTTAGTGAGTAAAATATTCCCTT
TCATACTTTATAACATAGAGACTGACTACATCGCCCTACTACCAGACAACCAACCGAAGATTCAGAACCGTTTCGCTGCTACCATGTCGAAGATGGCTCTTCTTGGCCAAGACAAGACCA
AATTGATTGACTGTTCCGATGTTATCCCCACCCCTCCTGCCCTTGTCGGAGCGGCCCACTTACCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGCG
GTACGTGCACATGTTTCCCTGG
ATAAATGAGGGGTCTCACCATCTGTGATCAGTGCGCCGCGACGCCTTTCCCTGCTCTTACTGCTGACCCAGGTGAATACATGCGGTGTTAACATTTTATCACCGGGCCATTTGAACTGAC
TGATATCTCTCTTCAGGCCCAGTAACCTCCGTCCCTCCCGTGTAAGTTTTCAGTCACCCAGTATGTTATGGCGCGCTCATTGTCTACGTCTCCTACAGCCCTGGATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCCGCTCTCGCGCTTGCGCTCGGCGCCGCTGTCCAGTTCGCGAGTGCTGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGACGACGGACGCACCACCGCA
AATGCTGCATGTTGCATTCTGTTCCCCATCCTCGATGACATCCAAGAAAACCTCTTCGACGGTGCCCAGTGTGGAGAAGAG
GTGCACGAGTCCCTTCGTTTGACTTTCCACGATGCAATC
GGTTTCTCTCCTACTTTAGG
CGGAGGAGGAGCTGACGGTTCCATCATCGCGTTCGACACCATTGAGACTAATTTCCCCGCCAATGCTGGCATCGATGAAATCGTCAGTGCTCAGAAGCCA
TTCGTGGCTAAACACAACATCTCCGCCGGCGACTT
CATTCAATTTGCTGGCGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCTTTCTTCTTGGGTCGCCCGGATGCCGTG
GCCGCCTCCCCGGACCACCTCGTGCCAGAGCCTTTTG
ATTCTGTTGACTCCATTCTTGCCAGAATGGGTGACGCAGGCTTCAGTCCCGTCGAGGTTGTTTGGCTCCTGGCTTCGCACTCC
ATTGCCGCTGCCGACAAGGTTGACCCATCG
ATTCCTGGAACGCCATTCGATTCAACCCCCGGAGTTTTTGATTCTCAATTCTTCATCGAAACGCAACTTAAAGGCAGACTCTTCCCAGGC
ACTGCTGACAACAAGGGAGAAGCCCAATCTCCATTGCAAGGAGAGATCAGGCTTCAGTCCGATCACTTG
TTGGCTAGAGACCCCCAGACTGCCTGCGAATGGCAGTCCATGGTTAACAAC
CAACCGAAGATTCAGAACCGTTTCGCTGCTACCATGTCGAAGATGGCTCTTCTTGGCCAAGACAAGACCAAATTGATTGACTGTTCCGATGTTATCCCCACCCCTCCTGCCCTTGTCGGA
GCGGCCCACTTACCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGCG
TGCGCCGCGACGCCTTTCCCTGCTCTTACTGCTGACCCAGGCCCAGTAACCTCCGTCCCTCCCGTCCCTGGA
TCGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGCAATGTC TTTCAAGACG CTCTCCGCTC TCGCGCTTGC GCTCGGCGCC GCTGTCCAGT TCGCGAGTGC TGCTGTGCCT CTCGTCCAGA AACGCGCAAC TTGCGACGAC GGACGCACCA  CCGCAAATGC TGCATGTTGC ATTCTGTTCC CCATCCTCGA TGACATCCAA GAAAACCTCT TCGACGGTGC CCAGTGTGGA GAAGAGGTGC ACGAGTCCCT TCGTTTGACT TTCCACGATG  CAATCGGTTT CTCTCCTACT TTAGGCGGAG GAGGAGCTGA CGGTTCCATC ATCGCGTTCG ACACCATTGA GACTAATTTC CCCGCCAATG CTGGCATCGA TGAAATCGTC AGTGCTCAGA  AGCCATTCGT GGCTAAACAC AACATCTCCG CCGGCGACTT CATTCAATTT GCTGGCGCCG TTGGAGTCTC CAACTGCCCT GGTGGTGTCA GGATTCCTTT CTTCTTGGGT CGCCCGGATG  CCGTGGCCGC CTCCCCGGAC CACCTCGTGC CAGAGCCTTT TGATTCTGTT GACTCCATTC TTGCCAGAAT GGGTGACGCA GGCTTCAGTC CCGTCGAGGT TGTTTGGCTC CTGGCTTCGC  ACTCCATTGC CGCTGCCGAC AAGGTTGACC CATCGATTCC TGGAACGCCA TTCGATTCAA CCCCCGGAGT TTTTGATTCT CAATTCTTCA TCGAAACGCA ACTTAAAGGC AGACTCTTCC  CAGGCACTGC TGACAACAAG GGAGAAGCCC AATCTCCATT GCAAGGAGAG ATCAGGCTTC AGTCCGATCA CTTGTTGGCT AGAGACCCCC AGACTGCCTG CGAATGGCAG TCCATGGTTA  ACAACCAACC GAAGATTCAG AACCGTTTCG CTGCTACCAT GTCGAAGATG GCTCTTCTTG GCCAAGACAA GACCAAATTG ATTGACTGTT CCGATGTTAT CCCCACCCCT CCTGCCCTTG  TCGGAGCGGC CCACTTACCG GCGGGATTTT CTCTTAGCGA TGTAGAGCAA GCGTGCGCCG CGACGCCTTT CCCTGCTCTT ACTGCTGACC CAGGCCCAGT AACCTCCGTC CCTCCCGTCC  CTGGATCGTA AATGCTTCGA TACCTGAATA TGCTCGTTCT GCTGCTATGA ACTTCCAATT TTTGCCATTG GGTCTGTATT CGATTCTAGA TGTTTGTGAT ATCAACTGTG TATAAATGAT 
CTTTTGAAAT ATACTTTTTT CTGC 

Retrieve as FASTA