Entry information : CsaPrx07 (Cucsa.153400.1 / CUSCUPER)
Entry ID 23
Creation 2006-03-23 (Christophe Dunand)
Last sequence changes 2011-06-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx07 (Cucsa.153400.1 / CUSCUPER)
Name (synonym) CsaPrx07 (Cucsa.153400.1 / CUSCUPER)
Class Class III peroxidase    [Orthogroup: Prx203]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx07
start..stop
S start..stop
CsaPrx06 411 1.58e-145 1..318 1..322
CsaPrx55 412 1.63e-145 9..318 12..319
CmPrx02 406 3.11e-143 7..318 11..326
CsaPrx03 401 4.11e-141 7..318 5..320
Gene structure Fichier Exons


exon

Literature and cross-references CsaPrx07 (Cucsa.153400.1 / CUSCUPER)
Literature Morgens,P.H., Callahan,A.M., Dunn,L.J. and Abeles,F.B.Isolation and sequencing of cDNA clones encoding ethylene-induced putative peroxidases from cucumber cotyledons PMB (5), 715-725 (1990)
Protein ref. UniProtKB:   P19135
DNA ref. Phytozome 12:   scaffold01124 (521161..519117)
mRNA ref. GenBank:   M32742
Protein sequence: CsaPrx07 (Cucsa.153400.1 / CUSCUPER)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (296)
PWM (Da):   %s   34822.4 (32252.0) Transmb domain:   %s   o30-52i
PI (pH):   %s   6.86 (6.12) Peptide Signal:   %s   cut: 23 range:23-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLFRVAFFLFLGLMVRASQAQLCPTFYDESCPDVSNIVRRVVQQALVSDERAGARLIRLHFHDCFVNGCDGSVLLEDQPGVVSELAAPGNANITGFNIVNNIKAAVEKACPGVVSCAD
ILAIASVESVNLAGGPCWEVQLGRRDSRRANLQGAIDGLPSPFENVTQLKRKFDRVDLDSTDLVALSGAHTFGKSRCQFFDRRLNVSNPDSTLNPRYAQQLRQACSSGRDTFVNLDPTTP
NKFDKNYYTNLQSNTGLLTSDQVLHSTPGEDTVKIVNLFAASQNQFFESFGQSMINMGNIQPLTGNQGEIRSNCRRLN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs (DN909245, M32742).
DNA
Send to BLAST
CDS
Send to BLAST