Entry information : AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Entry ID 230
Creation 2006-02-10 (Filippo Passardi)
Last sequence changes 2016-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-03-04 (Christophe Dunand)
Peroxidase information: AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Name AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Endoderm
Flowers
Green siliques
Mixed tissues
Roots
Siliques
Vascular tissue
Xylem
Inducers Dark growth
Drought
Lignification
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx64
start..stop
S start..stop
AhalPrx17 641 0 1..317 1..317
AlyPrx64 639 0 1..317 1..317
BstrPrx12 638 0 1..317 1..317
CrubPrx43 634 0 1..317 1..317
Gene structure Fichier Exons


exon

Literature and cross-references AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Literature REFERENCE 1 Tokunaga N, Kaneta T, Sato S, Sato Y. Analysis of expression profiles of three peroxidase genes associated with lignification in Arabidopsis thaliana. Physiol Plant. 2009 Jun;136(2):237-49.
REFERENCE 2 Yi Chou, E., Schuetz, M., Hoffmann, N., Watanabe, Y., Sibout, R., Samuels, A. L. Distribution, Mobility and Anchoring of Lignin-Related Oxidative Enzymes in Arabidopsis Secondary Cell Walls. JExBot 2018
REFERENCE 3 Kamiya T, Borghi M, Wang P, Danku JM, Kalmbach L, Hosmani PS, Naseer S, Fujiwara T, Geldner N, Salt DE. The MYB36 transcription factor orchestrates Casparian strip formation. PNAS 2015
REFERENCE 4 Tokunaga N, Kaneta T, Sato S, Sato Y. Analysis of expression profiles of three peroxidase genes associated with lignification in Arabidopsis thaliana. Physiol Plant. 2009 Jun;136(2):237-49.
Protein ref. UniProtKB:   Q43872
DNA ref. Phytozome 12:   Chr5 (16852702..16854021)
mRNA ref. GenBank:   NM_123583
Cluster/Prediction ref. Phytozome Gene 12:   19666549 UniGene:   At.23304
Omic ref. AtProteome:   At5g42180 ATTED-II:   At5g42180 e-FP Browser:   At5g42180 ePlant:   At5g42180 Genevestigator:   At5g42180 TAIR:   At5g42180
Protein sequence: AtPrx64(At5g42180 / PER64 / AtperoxP64 / PRXR4 / ATP17a / AtP17 / Atprxr4ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317
PWM (Da):   %s   34527.46 Transmb domain:   %s   i2-24o
PI (pH):   %s   8.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAHMLNLLVIVIFVVSFDVQALSPHYYDHTCPQADHIVTNAVKKAMSNDQTVPAALLRMHFHDCFVRGCDGSVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKALEEQCPGIVSCADI
LSLAARDAVAL
SGGPTWAVPKGRKDGRISKAIETRQLPAPTFNISQLRQNFGQRGLSMHDLVALSGGHTLGFAHCSSFQNRLHKFNTQKEVDPTLNPSFAARLEGVCPAHNTVKNAGSNM
DGTVTSFDNIYYKMLIQGKSLFSSDESLLAVPSTKKLVAKYANSNEEFERAFVKSMIKMSSISGNGNEVRLNCRRVR

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 10 cDNA and 41 EST mainly from siliques.
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST