Entry information : PerVP02 (VSP1)
Entry ID 2302
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2017-04-28 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-28 (Catherine Mathe)
Peroxidase information: PerVP02 (VSP1)
Name (synonym) PerVP02 (VSP1)
Class Versatile peroxidase    [Orthogroup: VP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus eryngii    [TaxId: 5323 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PerVP02
start..stop
S start..stop
PoVP02_PC9 654 0 1..357 1..351
PoVP02_PC15 654 0 1..357 1..351
PoVP02_Florida 653 0 1..357 1..351
PoVP05_PC9 516 0 1..370 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1010..1089 80 N° 2 1133..1256 124 N° 3 1310..1371 62 N° 4 1425..1574 150
N° 5 1626..1747 122 N° 6 1796..1871 76 N° 7 1926..1962 37 N° 8 2018..2025 8
N° 9 2077..2157 81 N° 10 2211..2280 70 N° 11 2336..2345 10 N° 12 2397..2432 36
N° 13 2493..2665 173 N° 14 2719..2764 46 N° 15 2823..2847 25 N° 16 2901..2913 13
join(1010..1089,1133..1256,1310..1371,1425..1574,1626..1747,1796..1871,1926..196 2,2018..2025,2077..2157,2211..2280,2336..2345,2397..2432,2493..2665,2719..2764,2 823..2847,2901..2913)


exon

Literature and cross-references PerVP02 (VSP1)
Literature Camarero S., Sarkar S., Ruiz-Duenas F.J., Martinez M.J., Martinez A.T. Description of a versatile peroxidase involved in the natural degradation of lignin that has both manganese peroxidase and lignin peroxidase substrate interaction sites. J. Biol. Chem. 274:10324-10330(1999).
Protein ref. UniProtKB:   Q9UVP6
DNA ref. GenBank:   AF175710
Protein sequence: PerVP02 (VSP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   370 (350)
PWM (Da):   %s   38934.26 (37002.2)  
PI (pH):   %s   4.41 (4.36) Peptide Signal:   %s   cut: 21 range:21-370
Sequence 411
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAKLSAFVLALGATVALGESPTHRCLNKRVTCATGQTTANEACCALFPILDDIQTNLFDGAQCGEEVHESLRLTFHDAIAFSPALTNAGQFGGGGADGSMIIFSDTEPNFHANLGIDEIVEAQKPFIARHNISAADFIQFAGAIGVSNCAGAPRLNFFLGRPDATQIPPDGLVPEPFDDVTKILSRMGDAGFSTVEVVWLLASHTIAAADHVDPSIPGTPFDSTPSTFDSQFFLETMLQGTAFPGTPGNQGEVESPLAGEMRLQSDFLLARDSRSACEWQSMVNNMPKIQNRFTQVMKKLSLLGHNQADLIDCSDVIPVPKTLTKAATFPAGKSQADVEIVCNAAATPFPALASDPGPVTAVPPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic sequence. Strain="ATCC90787/ CBS 613.91/ IJFM A169".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCGCTAAACTTTCCGCCTTCGTCTTGGCTCTTGGTGCTACCGTCGCGCTTGGTGAATCACCAACCCATCGATGGTGGAACACTGCGAGACTAATCATTTTCAAAAGGTGCACCT
AGTCTTAATAAACGCGTCACTTGTGCCACTGGCCAAACGACCGCCAACGAGGCTTGCTGCGCCCTGTTCCCGATTTTAGATGACATACAGACCAACCTCTTCGACGGTGCCCAATGTGGT
GAAGAG
GTAGATTTTTCGTCATATTGTATAACTGGCCGCTAACGCATAGTAATGTCTAGGTGCACGAGTCCTTGCGCTTGACATTCCACGACGCGATTGCATTCTCCCCAGCATTGACCA
A
GTAACGTCAACTGGTTTGATTATCGCGCCAGCTGTACTCACAATTATCTTCAGCGCTGGCCAGTTCGGAGGCGGTGGTGCGGACGGTTCTATGATCATCTTCAGTGACACCGAGCCCAA
CTTCCACGCCAACCTGGGCATCGATGAAATTGTTGAAGCCCAGAAGCCGTTCATCGCTCGTCACAACATCAGCGCTGCCGACTT
GTACGTAGCGACACTCCCTCGTCATAATTAGCACTC
AAAATCCTCTTCTAGCATTCAATTCGCCGGTGCCATTGGCGTCAGCAACTGCGCTGGTGCTCCCCGCTTGAACTTCTTCCTGGGTCGCCCTGATGCCACCCAGATTCCACCTGACGGCCT
CGTCCCGGAGCCTTTCG
GTATTCTCCTTTAACCTATATCACGCCATCAGCTAATTTCGCCTTCAGATGATGTGACTAAGATTCTCAGCAGGATGGGTGACGCTGGATTCAGCACTGTCGA
AGTCGTCTGGCTGCTTGCCTC
GTAAGCTGTCTTCAATATTTACCCAGCTTCTAGAAATTAATGGTGTCTTGACAGCCACACGATCGCTGCAGCCGATCATGTTGACCCCTCCGTAAGTTC
TCCTTGCAAATCTCGATGTTTTCGCTTGTTGACCATATTGTAAATAGATTCCCGGGTACAGATATCCTCGTTTGTGATATCTTTCTCGCTAATGATAGATCTTTAGAACTCCCTTCGACT
CAACTCCATCTACCTTCGATTCTCAATTCTTCTTGGAGACAATGTTGCAAGGGACTGCCTTCCCAGG
GTAATAATTCGTCGCTGATATTGTCGGGATCGTAGTGCTAACTTGAAGCTCAG

AACCCCAGGTAACCAGGGTGAAGTTGAATCGCCACTTGCAGGTGAAATGAGACTCCAATCCGACTTCTTA
GTAGGTTGTCCTGCTCCGATGCGAAGACACATTTTCTAATATCTCACCCA
TTCAGCTTGCCCGAGGTAATAAATATACAGCCGTTGTCAGCGGTATCTATTAAACATCATGTACAGACTCGAGGAGTGCCTGTGAATGGCAGTCCATGGTCAGTAAGTACTACATTCCCG
TGTCTATATTTGACTGTTGTGGATTCTAACAAAACGAATTAGACAACATGCCGAAGATCCAGAACAGATTCACCCAAGTCATGAAGAAGCTTTCTCTCCTCGGTCACAACCAGGCTGATC
TCATCGACTGCTCTGATGTTATTCCTGTTCCCAAGACGCTCACCAAGGCTGCCACCTTCCCCGCTGGCAAGAGTCAGGCCGATGTCGAGATTGTC
GTAGGTCTTATCGTGTATTACAGAA
TACTCGTTACCCACAACTATCCGTACAGTGCAATGCTGCTGCTACACCCTTCCCCGCCCTCGCCAGTGACCCTGGTTAGTTCCTTCAGCCCTCAACCAGTCTTTGCATAGCTAACTGACT
TCGGTTTTATAGGCCCAGTCACTGCTGTTCCCCCCGTGTACGCCCCACATCTCGCCCTTCGCCTATTCAACAAGCTAACATATTGTGCAGCCCACCTTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCGCTAAACTTTCCGCCTTCGTCTTGGCTCTTGGTGCTACCGTCGCGCTTGGTGAATCACCAACCCATCGATGTCTTAATAAACGCGTCACTTGTGCCACTGGCCAAACGACCG
CCAACGAGGCTTGCTGCGCCCTGTTCCCGATTTTAGATGACATACAGACCAACCTCTTCGACGGTGCCCAATGTGGTGAAGAG
GTGCACGAGTCCTTGCGCTTGACATTCCACGACGCGA
TTGCATTCTCCCCAGCATTGACCAA
CGCTGGCCAGTTCGGAGGCGGTGGTGCGGACGGTTCTATGATCATCTTCAGTGACACCGAGCCCAACTTCCACGCCAACCTGGGCATCGATGAAA
TTGTTGAAGCCCAGAAGCCGTTCATCGCTCGTCACAACATCAGCGCTGCCGACTT
CATTCAATTCGCCGGTGCCATTGGCGTCAGCAACTGCGCTGGTGCTCCCCGCTTGAACTTCTTCC
TGGGTCGCCCTGATGCCACCCAGATTCCACCTGACGGCCTCGTCCCGGAGCCTTTCG
ATGATGTGACTAAGATTCTCAGCAGGATGGGTGACGCTGGATTCAGCACTGTCGAAGTCGTCT
GGCTGCTTGCCTC
CCACACGATCGCTGCAGCCGATCATGTTGACCCCTCCATTCCCGGAACTCCCTTCGACTCAACTCCATCTACCTTCGATTCTCAATTCTTCTTGGAGACAATGTTGC
AAGGGACTGCCTTCCCAGG
AACCCCAGGTAACCAGGGTGAAGTTGAATCGCCACTTGCAGGTGAAATGAGACTCCAATCCGACTTCTTACTTGCCCGAGACTCGAGGAGTGCCTGTGAAT
GGCAGTCCATGGTCA
ACAACATGCCGAAGATCCAGAACAGATTCACCCAAGTCATGAAGAAGCTTTCTCTCCTCGGTCACAACCAGGCTGATCTCATCGACTGCTCTGATGTTATTCCTG
TTCCCAAGACGCTCACCAAGGCTGCCACCTTCCCCGCTGGCAAGAGTCAGGCCGATGTCGAGATTGTC
TGCAATGCTGCTGCTACACCCTTCCCCGCCCTCGCCAGTGACCCTGGCCCAG
TCACTGCTGTTCCCCCCGT
CCCACCTTCGTAA

Retrieve as FASTA