Entry information : PerVP02 (VSP1)
Entry ID 2302
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2017-04-28 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-28 (Catherine Mathe)
Peroxidase information: PerVP02 (VSP1)
Name (synonym) PerVP02 (VSP1)
Class Versatile peroxidase    [Orthogroup: VP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus eryngii    [TaxId: 5323 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PerVP02
start..stop
S start..stop
PoVP02_PC9 704 0 1..370 1..364
PoVP02_PC15 704 0 1..370 1..364
PoVP02_Florida 702 0 1..370 1..364
PoVP05_PC9 516 0 1..370 1..361
Gene structure Fichier Exons


exon

Literature and cross-references PerVP02 (VSP1)
Literature Camarero S., Sarkar S., Ruiz-Duenas F.J., Martinez M.J., Martinez A.T. Description of a versatile peroxidase involved in the natural degradation of lignin that has both manganese peroxidase and lignin peroxidase substrate interaction sites. J. Biol. Chem. 274:10324-10330(1999).
Protein ref. UniProtKB:   Q9UVP6
DNA ref. GenBank:   AF175710
Protein sequence: PerVP02 (VSP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   370 (350)
PWM (Da):   %s   38934.26 (37002.2)  
PI (pH):   %s   4.41 (4.36) Peptide Signal:   %s   cut: 21 range:21-370
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAKLSAFVLALGATVALGESPTHRCLNKRVTCATGQTTANEACCALFPILDDIQTNLFDGAQCGEVHESLRLTFHDAIAFSPALTNAGQFGGGGADGSMIIFSDTEPNFHANLGIDEIVEAQKPFIARHNISAADFIQFAGAIG
VSNCAGAPRLNFFLGRPDATQIPPDGLVPEP
DDVTKILSRMGDAGFSTVEVVWLLASHTIAAADHVDPIPGTPFDSTPSTFDSQFFLETMLQGTAFPGTPGNQGEVESPLAGEMRLQSDFLARDSRSACEWQSMVNNMPKIQNRFTQVMKKLSLLGHNQADLIDCSDVIPVPKTLTKAATFPAGKSQADVEICNAAATPFPALASDPGPVTAVPPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic sequence. Strain="ATCC90787/ CBS 613.91/ IJFM A169".
DNA
Send to BLAST
CDS
Send to BLAST