Entry information : PpaAPx01 (PP00152G00440 / Phypa1_6-PACid_18071284 / Phypa1_6-PACid_18071320)
Entry ID 2325
Creation 2006-03-04 (Christophe Dunand)
Last sequence changes 2006-03-04 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-12-08 (Christophe Dunand)
Peroxidase information: PpaAPx01 (PP00152G00440 / Phypa1_6-PACid_18071284 / Phypa1_6-PACid_18071320)
Name (synonym) PpaAPx01 (PP00152G00440 / Phypa1_6-PACid_18071284 / Phypa1_6-PACid_18071320)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaAPx01
start..stop
S start..stop
CpuAPx01 477 1.22e-173 1..250 1..250
AangAPx02 465 4.85e-169 1..249 1..249
AangAPx03 460 5.85e-167 1..249 1..249
PpaAPx[P]04 454 2.56e-165 25..246 1..222
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2325' 'join(439494..439578,439933..439966,440211..440385,440572..440637,440889..440937,441153..441238,441396..441475,441597..441699,441886..441944,442073..442088)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 439494..439578 83 N° 2 439933..439966 32 N° 3 440211..440385 173 N° 4 440572..440637 64
N° 5 440889..440937 47 N° 6 441153..441238 84 N° 7 441396..441475 78 N° 8 441597..441699 101
N° 9 441886..441944 57 N° 10 442073..442088 14  
join(439494..439578,439933..439966,440211..440385,440572..440637,440889..440937, 441153..441238,441396..441475,441597..441699,441886..441944,442073..442088)


exon

Literature and cross-references PpaAPx01 (PP00152G00440 / Phypa1_6-PACid_18071284 / Phypa1_6-PACid_18071320)
Literature Hohe A., Egener T., Lucht J.M., Holtorf H., Reinhard C., Schween G., Reski R.; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
Protein ref. UniProtKB:   Q8GU36
DNA ref. Phytozome 12:   scaffold_152 (439494..442088)
mRNA ref. JGI transcript:   63071
Cluster/Prediction ref. UniGene:   Ppa.2912
Protein sequence: PpaAPx01 (PP00152G00440 / Phypa1_6-PACid_18071284 / Phypa1_6-PACid_18071320)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27562.99  
PI (pH):   %s   6.1
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSYPNVSEKYAALIEKARRKIRGMVAEKNCAPIILRLAWHGSGTYDQESKTGGPLGTIRFGQELAHGANAGLDIAVNLLQPIKEQFPELSYADFYLAGVVAVEVTGGPTIPFHPGRKD
HETCPVEGRLPDATK
GLDHLRCVFTKQMGLTDKDIVVLSGAHTGRCHKDRSGFEGAWTPNPLRFDNSYFQVLLEGEKDGLIMLPSDKALLDEPKTRELVELYADEDKFFEDYAESHMKLS
EL
GFAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns and 1 extra intron in 5'UTR) and 473 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGTCTTACCCAAACGTCAGTGAGAAGTACGCTGCGCTCATTGAGAAAGCCCGCAGGAAGATACGGGGGATGGTAGCAGAGGTAAGAGGTTACGTCAGTTAAGGTAGGCGCGGC
AAGCTCTAAGATAATGAGATAGTCATTAGATAATGCGCGTGTAATTGTATTGAGGGTCAGTCGAGGTTGTCGACATGGGTATGGTTCAATTCTGGAATGTTGTGCAGTCGACAGCATAGG
TGGTTGAATAAGTAAAAGGTGTGAGCATATTTTTGTGAGTGCTGGCGCGCGTTGATGCTGCACGCATTAGACACTTTTTCTACGATCTGCGTCATAATATTGATAGTAGCTGTGGGGTTA
CGGACCTGTGGGGTGCCATCGGTAGTTTACTACGGATGGGAGATCGTTCTAACCAAGGGTATCAATGTTGTTGATTTGCAGAGAAGAACTGCGCACCGATCATCCTTCGTCTCGCGCGTA
AGTTTTGCGACAAATGCTTTATTTTCTTACACTGTTTTTAAAAAATGTGATCGCGCACTGTAATCTGGAGTAAATTCGCATGGTTTTACATCATTTCGTTTCTGGCGAAAATGTGTTGTT
TGGACAGGATGATGAGAATTGAGTTTAGAATGGAGTTCGGAAGGGGCTCACACGGAGTGCGAGGTAGAGTTGGTAGTTCATTTTTGTTCAGTGAGTGAGCTGTTGCTCTGACTTCTTGCA
GATGGCACGGGTCGGGAACTTACGATCAGGAGTCGAAGACAGGAGGTCCTCTTGGAACCATCCGGTTCGGGCAGGAGCTTGCGCACGGCGCCAACGCGGGGCTGGACATTGCAGTGAATC
TGCTGCAGCCCATCAAGGAGCAGTTTCCGGAGTTGTCGTACGCTGACTTTTACACG
CGGTAATGAATAAGAAGCGGGTTTGACGATGGGTGGGGCGAAGTAGGCTAGGTGGTTGCAGCAG
CGTTATTGGGGGGGGGGGTTGCAGGCACTGCAATGAGTGAGGAGGTGGGGAGCTCCAGGAATAGGTGTTGGGATTGGAGTGGGAAGAAGGTTGGATTCTAAGGTTTGATGTCATGCGGTT
GCAGCTGGCTGGAGTCGTTGCCGTGGAGGTGACAGGCGGGCCCACCATTCCTTTTCACCCTGGGCGCAAGAGGTAAGAGCCTGGCTGGGCATTCGGGGAGAAGTGCGAGTTTTGGTGGTT
GCTCCCGAATGCGGGATTCGTGAAGCTGTGATGTTGTGAGAAGCAGGGGAAGTGGCGATTGGGGAGTGAGTCTTGAAGGGTTCTGACGTAGACGTGTGGGATGCGGGTGGAAGTGAGAAG
GTGGGGACAGCGTGGGATGGTTGAGAGCGAAGCGGGACTTAATACTGATGTCCGAGTGTGGTGAATGTGGTGTGTGTGTGCAGGATCATGAGACATGCCCCGTGGAGGGTCGGCTTCCCG
ACGCCACGAAGG
GGGTACGTAATCGGGTGGTGTAAGGTGCATTTTGGAGGATGTGAGGGCGATGTTGTTGGGTGTGAGGAGGGATGACGAGTTTCCGGATGCGGGTTGTGTTGATGAGAG
GAGTTTAGATGTGGTTGTCGTGTGCGGCTTCCAGGTGAAGTAGGCATGTGAAGGGGTAGGGGGAGGATATTGGTGGAAGTGACGTGTTGGTGGGCGTGTGGGTGGGCAGGTTTGGATCAC
CTCCGATGCGTGTTCACGAAGCAGATGGGGTTGACGGATAAAGACATTGTGGTGCTGTCGGGTGCACACACTCTG
TGGTAGGACATGGTGGGAATCGGGAGTGCCGAGATGGTGGTGGTG
TTGTGGAATGGTGCAAGGTTTGGGGAAAGGGGCGGTGGGTGAATTGGGTGGTGTGAGGAGGGTGAGTGGGTGCAGTGACTGAGCGGTGGATGTTGGTGGTGTGCGGTGTTGCAGGGGAGG
TGCCACAAGGACCGGTCCGGATTTGAGGGAGCATGGACGCCGAACCCCCTTAGATTCGACAACTCGTACTTCCA
CAGTGAGTGATGTGTGAATTGATGCAGGCCGGTGGGTGGGTTATGA
AGGCGATGCGAGTGGGTGAGATGGAGTTATCGTTGAGGATGTGGGCTAATGATTGTGATGGACATGGTCGTGGGTAGGGTGCTGTTGGAGGGAGAGAAGGATGGACTGATCATGCTGCCA
TCCGACAAGGCTCTGCTGGATGAGCCGAAGACTCGTGAGTTGGTTGAGTTGTACGCGAAG
AGGTATGTGCCGTGTTTTGTTTGGTGGTGACGTGGTTGTGTCGGAAAAAATCAGAATAGC
ATAGGGCCCATCGCCTTAAGGTAGTCTGTGTTAAGTGTAGAACGGATTGAGAGGGTGGTGTCCGGGTGCCATTGGTGAAGGTTGGTGGCGGTGATGATGTATTGAGTGGTGCTTGTGGGG
TGTGACAGGACGAGGACAAGTTTTTCGAAGACTACGCCGAGTCTCACATGAAGTTGTCAGAGCTAGGGGGTGAGTTCGCTGGTGTTGACAAGCCTCGCGTGCTTCTTTCTTACTTGAATA
TGTTTCTGGGTTCTTTCTTGTTTTTGGTCTGCAATTGACTTTCTGCTGTGTATTAATTTGATGTGGCTTGGTTCTAGATTTGCCGAGGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGTCTTACCCAAACGTCAGTGAGAAGTACGCTGCGCTCATTGAGAAAGCCCGCAGGAAGATACGGGGGATGGTAGCAGAGAAGAACTGCGCACCGATCATCCTTCGTCTCGCA
TGGCACGGGTCGGGAACTTACGATCAGGAGTCGAAGACAGGAGGTCCTCTTGGAACCATCCGGTTCGGGCAGGAGCTTGCGCACGGCGCCAACGCGGGGCTGGACATTGCAGTGAATCTG
CTGCAGCCCATCAAGGAGCAGTTTCCGGAGTTGTCGTACGCTGACTTTTACACG
CTGGCTGGAGTCGTTGCCGTGGAGGTGACAGGCGGGCCCACCATTCCTTTTCACCCTGGGCGCAAG
GATCATGAGACATGCCCCGTGGAGGGTCGGCTTCCCGACGCCACGAAGGGTTTGGATCACCTCCGATGCGTGTTCACGAAGCAGATGGGGTTGACGGATAAAGACATTGTGGTGCTGTCG
GGTGCACACACTCTG
GGGAGGTGCCACAAGGACCGGTCCGGATTTGAGGGAGCATGGACGCCGAACCCCCTTAGATTCGACAACTCGTACTTCCAGGTGCTGTTGGAGGGAGAGAAGGAT
GGACTGATCATGCTGCCATCCGACAAGGCTCTGCTGGATGAGCCGAAGACTCGTGAGTTGGTTGAGTTGTACGCGAAG
GACGAGGACAAGTTTTTCGAAGACTACGCCGAGTCTCACATG
AAGTTGTCAGAGCTAGG
ATTTGCCGAGGCGTGA

Retrieve as FASTA