Entry information : DsMnP02 (mnp2)
Entry ID 2340
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2011-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-02 (Catherine Mathe (Scipio))
Peroxidase information: DsMnP02 (mnp2)
Name (synonym) DsMnP02 (mnp2)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsMnP02
start..stop
S start..stop
DsMnP03 677 0 1..390 1..388
DsMnP01 660 0 1..387 1..388
DsMnP04 652 0 1..389 1..389
PrMnP02 628 0 1..389 1..388
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 466083..466214 132 N° 2 465969..466020 52 N° 3 465887..465913 27 N° 4 465794..465833 40
N° 5 465555..465732 178 N° 6 465271..465492 222 N° 7 464798..465212 415 N° 8 464622..464728 107
complement(join(464622..464728,464798..465212,465271..465492,465555..465732,4657 94..465833,465887..465913,465969..466020,466083..466214))


exon

Literature and cross-references DsMnP02 (mnp2)
Literature Li D., Li N., Ma B., Mayfield M.B., Gold M.H. Characterization of genes encoding two manganese peroxidases from the lignin-degrading fungus Dichomitus squalens(1). Biochim. Biophys. Acta 1434:356-364(1999).
Protein ref. UniProtKB:   Q9P901
DNA ref. JGI genome:   scaffold_12 (466214..464622)
Protein sequence: DsMnP02 (mnp2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   390 (370)
PWM (Da):   %s   40831.15 (38716.0)  
PI (pH):   %s   4.38 (4.34) Peptide Signal:   %s   cut: 21 range:21-390
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKLWSMLPLVALATVATAAPSRQTVCSDGTVVPDSVCCEFVPLAQALQKEVLMGDCGEDAHELLRLTFHDAIAISRSKGPSAGGGADGSMLIFPTVEPAFFANLGIADSVNNLIPFLSQFPKISAGDLVQFAGAVAVGNCGAPQLEFRAGRPNATAPAIEGLIPEPQNNITEILERFDDAGGFSPFEVVSLLASHTVARADHVDPTLDAAPFDSTPFTFDTQIFLEVLLKGVGFPGTGNNTGEVSSPLPVSSGTDVGELRLQSDFGLAHDERTACFWQGFVNEQEFMAQSFKAAMAKLAVLGHNADDLVDCSAVVPKPKPATGKPASFPATKGPKDLELSCKSKKFPTLTTDHGAQETLIPHCSNGSMNCTTVQFDGPATNFDGDDS

Retrieve as FASTA  
Remarks Complete sequence from genomic sequence (7 introns). Strain="CBS 432.34".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGCTGTGGTCCATGCTCCCGCTCGTCGCGCTCGCCACCGTGGCGACCGCGGCCCCGAGTCGCCAGACGGTGTGCTCGGACGGCACCGTCGTCCCCGACTCGGTGTGCTGC
GAGTTCGTGCCC
GTAAGTCGCGGCTGCGCTGCGCTTTACGCCGATGCCGGGCACTCAAGCTTGCTCTCCTATAGCTTGCACAGGCACTTCAGAAAGAGGTGCTCATGGGCGATTGCGGCG
AAGACG
GTAGGCCGTCCCCGTGTAGAATCGAGAATAACAGCCTGACGTTGGGTTATTGCAGCTCACGAGCTCCTCCGTCTCACTTTCCGTAAGCTACACCTGTCGGCTGCGTTTTGACGG
CATGTTGACGGTACATTGCAGACGATGCCATCGCCATCTCGCGCAGCAAGGGCCCCTCGGCGTAAGTATCGATCACATGTGGTTGACTAAAGCTTTTGGCACTGACCCTAGTTGGTGCAC
AGCGGTGGAGGAGCTGACGGCTCCATGCTCATCTTCCCGACCGTCGAGCCCGCCTTCTTCGCCAACCTTGGTATCGCCGACTCGGTGAACAACCTCATCCCCTTCCTCTCGCAGTTCCCC
AAGATCTCCGCCGGCGATCTCGTCCAGTTCGCAGGTGCCGTCGCCGTCGGAAACTGCCCC
GTAAGCACTCCCTGCTCCTTTCAGAGTCTGCGTTGCCGTGCTGATGCGACTTCGCACAAT
AGGGTGCCCCCCAGCTCGAGTTCCGTGCTGGCCGTCCCAACGCGACCGCGCCCGCCATCGAAGGTCTGATTCCCGAGCCCCAGAACAACATCACTGAGATTCTGGAGCGGTTCGACGATG
CTGGAGGCTTCTCGCCCTTCGAGGTCGTCTCCCTCCTCGCTTCGCACACCGTTGCCCGTGCCGATCACGTCGACCCGACGCTCGACGCCGCGCCCTTCGACAGC
GTAAGTTGCCCCCTCT
CCTCCGTTCACGATGCCCGCTCACTCGACCTGCGCGCCATAGACCCCCTTCACGTTCGACACCCAGATCTTCCTCGAGGTGCTCCTCAAGGGCGTCGGCTTCCCTGGCACGGGCAACAAC
ACCGGCGAGGTGTCCTCCCCGCTCCCGGTCAGCAGCGGCACGGACGTCGGCGAGCTCCGGCTCCAGTCCGACTTCGGGCTCGCGCACGACGAGCGCACGGCGTGCTTCTGGCAGGGCTTC
GTGAACGAGCAGGAGTTCATGGCGCAGTCGTTCAAGGCCGCGATGGCGAAGCTCGCTGTGCTCGGCCACAACGCGGACGACCTCGTCGACTGCTCCGCCGTCGTGCCCAAGCCGAAGCCC
GCGACGGGCAAGCCCGCGTCGTTCCCCGCGACCAAGGGCCCGAAGGACCTCGAGCTCTCGTGCAAGTCCAAGAAGTTCCCCACGCTGACCACCGACC
GTGAGTGCCCGTACTTTCGTCTG
TTGTGCAGAACCAGAACTGTTGGCTGACCGCGACTCGCTTTGGCAGACGGTGCGCAGGAGACCCTCATCCCGCACTGCTCGAACGGCAGCATGAACTGCACGACCGTCCAGTTCGACGGC
CCCGCGACCAACTTCGACGGCGACGACTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGCTGTGGTCCATGCTCCCGCTCGTCGCGCTCGCCACCGTGGCGACCGCGGCCCCGAGTCGCCAGACGGTGTGCTCGGACGGCACCGTCGTCCCCGACTCGGTGTGCTGC
GAGTTCGTGCCC
CTTGCACAGGCACTTCAGAAAGAGGTGCTCATGGGCGATTGCGGCGAAGACGCTCACGAGCTCCTCCGTCTCACTTTCCACGATGCCATCGCCATCTCGCGCAGCAAG
GGCCCCTCGGC
CGGTGGAGGAGCTGACGGCTCCATGCTCATCTTCCCGACCGTCGAGCCCGCCTTCTTCGCCAACCTTGGTATCGCCGACTCGGTGAACAACCTCATCCCCTTCCTCTCG
CAGTTCCCCAAGATCTCCGCCGGCGATCTCGTCCAGTTCGCAGGTGCCGTCGCCGTCGGAAACTGCCCC
GGTGCCCCCCAGCTCGAGTTCCGTGCTGGCCGTCCCAACGCGACCGCGCCC
GCCATCGAAGGTCTGATTCCCGAGCCCCAGAACAACATCACTGAGATTCTGGAGCGGTTCGACGATGCTGGAGGCTTCTCGCCCTTCGAGGTCGTCTCCCTCCTCGCTTCGCACACCGTT
GCCCGTGCCGATCACGTCGACCCGACGCTCGACGCCGCGCCCTTCGACAGC
ACCCCCTTCACGTTCGACACCCAGATCTTCCTCGAGGTGCTCCTCAAGGGCGTCGGCTTCCCTGGCACG
GGCAACAACACCGGCGAGGTGTCCTCCCCGCTCCCGGTCAGCAGCGGCACGGACGTCGGCGAGCTCCGGCTCCAGTCCGACTTCGGGCTCGCGCACGACGAGCGCACGGCGTGCTTCTGG
CAGGGCTTCGTGAACGAGCAGGAGTTCATGGCGCAGTCGTTCAAGGCCGCGATGGCGAAGCTCGCTGTGCTCGGCCACAACGCGGACGACCTCGTCGACTGCTCCGCCGTCGTGCCCAAG
CCGAAGCCCGCGACGGGCAAGCCCGCGTCGTTCCCCGCGACCAAGGGCCCGAAGGACCTCGAGCTCTCGTGCAAGTCCAAGAAGTTCCCCACGCTGACCACCGACC
ACGGTGCGCAGGAG
ACCCTCATCCCGCACTGCTCGAACGGCAGCATGAACTGCACGACCGTCCAGTTCGACGGCCCCGCGACCAACTTCGACGGCGACGACTCGTAG

Retrieve as FASTA